KEGG   Mycobacterium tuberculosis H37Rv: Rv0417Help
Entry
Rv0417            CDS       T00015                                 

Gene name
thiG
Definition
(RefSeq) thiazole synthase
  KO
K03149  
thiazole synthase [EC:2.8.1.10]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rv0417 (thiG)
Enzymes [BR:mtu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.10  thiazole synthase
     Rv0417 (thiG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
502366..503124
Genome map
AA seq 252 aa AA seqDB search
MAESKLVIGDRSFASRLIMGTGGATNLAVLEQALIASGTELTTVAIRRVDADGGTGLLDL
LNRLGITPLPNTAGSRSAAEAVLTAQLAREALNTNWVKLEVIADERTLWPDAVELVRAAE
QLVDDGFVVLPYTTDDPVLARRLEDTGCAAVMPLGSPIGTGLGIANPHNIEMIVAGARVP
VVLDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAAAMAAAVTAGYLARCAGRIP
KRFWAQASSPAR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagtccaagttggttatcggtgaccgcagcttcgcctcgcggctcatcatgggt
actgggggtgcgaccaatctggcggtgctagagcaggctctgatcgcctcaggtaccgag
ctgaccaccgtcgcgatacgccgggtcgacgccgacgggggaaccggcctgctcgacctg
ctcaaccggctcggcatcacaccgctacccaacaccgcggggtcccgcagcgccgcggaa
gcggtcctgacagcgcagttggcccgtgaggcgctgaacaccaactgggtcaagctcgag
gtgattgccgacgaacgcaccctgtggcctgatgcggtcgaattagtccgggctgcagaa
caattggtggacgacggatttgtggtcctaccgtacacaaccgacgacccggtgctggcc
cgccggctagaagataccggttgcgcagcggtgatgccgctgggttcgccgatcggcacc
ggccttggtatcgccaacccgcacaatatcgagatgatcgtcgccggtgcccgcgttccc
gtggtgctggacgcgggcatcggtaccgccagcgatgccgcgttggcgatggagttgggt
tgcgatgccgtgttgttggccagtgcggtgacccgggccgccgacccgccggcgatggcc
gcggcgatggccgccgcggtgaccgccggatatctggcgcgttgcgcggggcggatcccg
aaacgcttctgggctcaggcttccagcccggcacgataa

DBGET integrated database retrieval system