KEGG   Mycobacterium tuberculosis H37Rv: Rv0423cHelp
Entry
Rv0423c           CDS       T00015                                 

Gene name
thiC
Definition
(RefSeq) phosphomethylpyrimidine synthase
  KO
K03147  
phosphomethylpyrimidine synthase [EC:4.1.99.17]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rv0423c (thiC)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.17  phosphomethylpyrimidine synthase
     Rv0423c (thiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(508582..510225)
Genome map
AA seq 547 aa AA seqDB search
MTITVEPSVTTGPIAGSAKAYREIEAPGSGATLQVPFRRVHLSTGDHFDLYDTSGPYTDT
DTVIDLTAGLPHRPGVVRDRGTQLQRARAGEITAEMAFIAAREDMSAELVRDEVARGRAV
IPANHHHPESEPMIIGKAFAVKVNANIGNSAVTSSIAEEVDKMVWATRWGADTIMDLSTG
KNIHETREWILRNSPVPVGTVPIYQALEKVKGDPTELTWEIYRDTVIEQCEQGVDYMTVH
AGVLLRYVPLTAKRVTGIVSRGGSIMAAWCLAHHRESFLYTNFEELCDIFARYDVTFSLG
DGLRPGSIADANDAAQFAELRTLGELTKIAKAHGAQVMIEGPGHIPMHKIVENVRLEEEL
CEEAPFYTLGPLATDIAPAYDHITSAIGAAIIAQAGTAMLCYVTPKEHLGLPDRKDVKDG
VIAYKIAAHAADLAKGHPRAQERDDALSTARFEFRWNDQFALSLDPDTAREFHDETLPAE
PAKTAHFCSMCGPKFCSMRITQDVREYAAEHGLETEADIEAVLAAGMAEKSREFAEHGNR
VYLPITQ
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaccgttgaaccgtcggtgaccacgggtcccatcgcgggcagcgccaaggcc
taccgtgaaatcgaggctcccggcagcggagctactctccaagtcccgtttcgacgggtg
cacttgtccaccggagaccacttcgacctctacgacacctccgggccctacaccgacacg
gacacggtgatcgacctgaccgcggggctgccgcataggcccggagtggttcgcgatcgg
ggcacccagctgcagcgggcccgcgccggggagatcaccgccgagatggcgttcatcgcc
gcccgcgaagacatgtccgccgagctagtgcgcgacgaggtcgcccgcggccgcgcggtg
atcccggccaaccaccaccaccccgagagcgagccgatgatcatcggcaaggcgttcgcg
gtgaaagtcaacgccaacatcggcaactcggcggtgacgagctcgatcgccgaggaggtc
gacaagatggtgtgggccacccgctggggggccgacaccatcatggacctgtccaccggc
aagaacatccacgaaacccgcgagtggatcctgcgcaattctcccgtgccggtcggcacc
gtgccgatctatcaggcgctggagaaagtcaagggcgatccgaccgagctgacctgggag
atctaccgcgacaccgtgatcgagcagtgtgagcaaggcgtggactacatgacggtgcac
gccggggtgctgctgcggtatgtgccgctgaccgccaagcgggtcaccggcatcgtgtcc
cgcgggggttcgatcatggccgcgtggtgtttggcacatcatcgggagtcgttcttgtac
accaactttgaggagctctgcgatattttcgcccgctacgacgtcaccttctcactcggt
gacgggctgcgaccagggtcgatcgctgatgccaacgacgccgcgcagttcgccgagctg
cgcaccctgggcgagctcaccaagatcgccaaagcccatggcgcacaggtgatgatcgag
gggccgggccatatcccaatgcacaagatcgtcgagaatgtgcggctggaagaggaactg
tgtgaggaggccccgttctacacgctgggtccgctggccaccgacatcgcgccggcctac
gaccacatcacctcggcgatcggtgcggccatcatcgcccaagccggtaccgcgatgctg
tgctacgtcacccccaaggagcacctcgggttgccggaccgcaaggacgtcaaggacggg
gtgatcgcctacaagatcgccgcgcatgcggccgatttggccaagggccatccgcgcgcc
caggagcgcgacgacgctttgagcacggcgcgtttcgagttccgctggaacgaccagttc
gcactgtcgctggatcccgacaccgcacgggaattccacgacgaaaccctgccggcggag
ccggccaagaccgcgcacttctgctcgatgtgcggaccgaagttctgctccatgcgcatc
acccaggacgtccgtgagtacgccgccgaacacgggcttgagaccgaagcggacatcgaa
gccgtgctcgccgccggaatggccgaaaagtcacgtgaattcgcagagcacggcaatcgg
gtgtatctcccgataacccagtga

DBGET integrated database retrieval system