KEGG   Mycobacterium tuberculosis H37Rv: Rv0458Help
Entry
Rv0458            CDS       T00015                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00138  
aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv0458
   00620 Pyruvate metabolism
    Rv0458
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Rv0458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
549675..551198
Genome map
AA seq 507 aa AA seqDB search
MTVFSRPGSAGALMSYESRYQNFIGGQWVAPVHGRYFENPTPVTGQPFCEVPRSDAADID
KALDAAHAAAPGWGKTAPAERAAILNMIADRIDKNAAALAVAEVWDNGKPVREALAADIP
LAVDHFRYFAAAIRAQEGALSQIDEDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPAL
AAGNTAVLKPAEQTPASVLYLMSLIGDLLPPGVVNVVNGFGAEAGKPLASSDRIAKVAFT
GETTTGRLIMQYASHNLIPVTLELGGKSPNIFFADVLAAHDDFCDKALEGFTMFALNQGE
VCTCPSRSLIQADIYDEFLELAAIRTKAVRQGDPLDTETMLGSQASNDQLEKVLSYIEIG
KQEGAVIIAGGERAELGGDLSGGYYMQPTIFTGTNNMRIFKEEIFGPVVAVTSFTDYDDA
IGIANDTLYGLGAGVWSRDGNTAYRAGRDIQAGRVWVNCYHLYPAHAAFGGYKQSGIGRE
GHQMMLQHYQHTKNLLVSYSDKALGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcttttcccgtcccggttccgccggggcgctgatgtcctatgaatcccggtac
caaaacttcatcgggggccagtgggtcgcgccggtccatgggcgctacttcgagaacccg
acgccggtgaccggccagccgttctgcgaggtgccgcgctccgacgcggccgacatcgac
aaggcgctcgacgccgcgcacgcggcggcgccggggtggggcaagaccgcaccggccgaa
cgggcggcgatcctcaacatgattgccgaccgcatcgacaagaacgccgccgcgctggcg
gtggccgaggtctgggacaacgggaaaccggtccgggaagcgctggccgccgatatcccg
ttggcggtcgatcacttccggtacttcgccgcggcgattcgcgcccaggagggcgcgctg
agccagatcgacgaggacaccgtggcctaccacttccacgagccgctcggcgtggtgggc
cagatcattccgtggaacttccccatcctgatggcggcctggaagctggcgccggcgttg
gcggccggcaacacggcggtgctcaaacccgccgagcagacacccgcttcggtgctctac
ctgatgtcgctgatcggtgatctgttgccgcccggggtggtcaacgtggtcaacggattc
ggcgccgaggccggcaagccgttggcctccagcgaccgcatcgccaaggtcgcgttcacc
ggggaaaccaccacggggcggctgatcatgcaatacgcctcgcacaacctgatcccggtc
accctggaactcggcggcaagagccccaacatcttcttcgccgacgtgctggccgcccac
gacgacttctgcgacaaggcgctggaaggcttcaccatgttcgccctcaaccagggcgag
gtgtgcacctgcccgtcgcgcagtctgatccaggccgacatctacgacgagttcctggag
ctggcggcgatccggaccaaggcggtccggcagggcgacccgctggacaccgaaaccatg
ctgggttcccaggcctccaacgaccagctggaaaaggtgttgtcctacatcgaaatcggc
aagcaagagggtgcggtgattatcgccggaggcgagcgcgccgaactaggcggcgacctg
tccggcggttattacatgcagccgacgatcttcaccggcaccaacaacatgcggattttc
aaggaggagatcttcgggccggtggtcgcggtgacgtcgttcaccgattacgacgacgcg
atcggcatcgccaacgacaccctctacggcttgggtgccggtgtgtggagccgcgacggc
aacactgcctatcgggccgggcgggacatccaggccggccgggtgtgggtcaactgctac
cacctctaccccgcgcacgcggcgttcggcggctacaagcagtccggcatcggccgggag
ggccaccagatgatgctgcagcactaccagcacaccaagaacctgctggtgtcctactcg
gataaggcgctggggttcttctga

DBGET integrated database retrieval system