KEGG   Mycobacterium tuberculosis H37Rv: Rv0462Help
Entry
Rv0462            CDS       T00015                                 

Gene name
lpdC
Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv0462 (lpdC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv0462 (lpdC)
   00020 Citrate cycle (TCA cycle)
    Rv0462 (lpdC)
   00620 Pyruvate metabolism
    Rv0462 (lpdC)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv0462 (lpdC)
   00640 Propanoate metabolism
    Rv0462 (lpdC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv0462 (lpdC)
   00280 Valine, leucine and isoleucine degradation
    Rv0462 (lpdC)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Rv0462 (lpdC)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Rv0462 (lpdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
552614..554008
Genome map
AA seq 464 aa AA seqDB search
MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVH
IFTKDAKAFGISGEVTFDYGIAYDRSRKVAEGRVAGVHFLMKKNKITEIHGYGTFADANT
LLVDLNDGGTESVTFDNAIIATGSSTRLVPGTSLSANVVTYEEQILSRELPKSIIIAGAG
AIGMEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQFKKLGVTILTATKVESIAD
GGSQVTVTVTKDGVAQELKAEKVLQAIGFAPNVEGYGLDKAGVALTDRKAIGVDDYMRTN
VGHIYAIGDVNGLLQLAHVAEAQGVVAAETIAGAETLTLGDHRMLPRATFCQPNVASFGL
TEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVADAKHGELLGGHLVGHDVAELL
PELTLAQRWDLTASELARNVHTHPTMSEALQECFHGLVGHMINF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgacccactatgacgtcgtcgttctcggagccggtcccggcgggtatgtcgcggcgatt
cgcgccgcacagctcggcctgagcactgcaatcgtcgaacccaagtactggggcggagta
tgcctcaatgtcggctgtatcccatccaaggcgctgttgcgcaacgccgaactggtccac
atcttcaccaaggacgccaaagcatttggcatcagcggcgaggtgaccttcgactacggc
atcgcctatgaccgcagccgaaaggtagccgagggcagggtggccggtgtgcacttcctg
atgaagaagaacaagatcaccgagatccacgggtacggcacatttgccgacgccaacacg
ttgttggttgatctcaacgacggcggtacagaatcggtcacgttcgacaacgccatcatc
gcgaccggcagtagcacccggctggttcccggcacctcactgtcggccaacgtagtcacc
tacgaggaacagatcctgtcccgagagctgccgaaatcgatcattattgccggagctggt
gccattggcatggagttcggctacgtgctgaagaactacggcgttgacgtgaccatcgtg
gaattccttccgcgggcgctgcccaacgaggacgccgatgtgtccaaggagatcgagaag
cagttcaaaaagctgggtgtcacgatcctgaccgccacgaaggtcgagtccatcgccgat
ggcgggtcgcaggtcaccgtgaccgtcaccaaggacggcgtggcgcaagagcttaaggcg
gaaaaggtgttgcaggccatcggatttgcgcccaacgtcgaagggtacgggctggacaag
gcaggcgtcgcgctgaccgaccgcaaggctatcggtgtcgacgactacatgcgtaccaac
gtgggccacatctacgctatcggcgatgtcaatggattactgcagctggcgcacgtcgcc
gaggcacaaggcgtggtagccgccgaaaccattgccggtgcagagactttgacgctgggc
gaccatcggatgttgccgcgcgcgacgttctgtcagccaaacgttgccagcttcgggctc
accgagcagcaagcccgcaacgaaggttacgacgtggtggtggccaagttcccgttcacg
gccaacgccaaggcgcacggcgtgggtgaccccagtgggttcgtcaagctggtggccgac
gccaagcacggcgagctactgggtgggcacctggtcggccacgacgtggccgagctgctg
ccggagctcacgctggcgcagaggtgggacctgaccgccagcgagctggctcgcaacgtc
cacacccacccaacgatgtctgaggcgctgcaggagtgcttccacggcctggttggccac
atgatcaatttctga

DBGET integrated database retrieval system