KEGG   Mycobacterium tuberculosis H37Rv: Rv0478Help
Entry
Rv0478            CDS       T00015                                 

Gene name
deoC
Definition
(RefSeq) 2-deoxyribose-5-phosphate aldolase
  KO
K01619  
deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv0478 (deoC)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     Rv0478 (deoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
567222..567896
Genome map
AA seq 224 aa AA seqDB search
MLGQPTRAQLAALVDHTLLKPETTRADVAALVAEAAELGVYAVCVSPSMVPVAVQAGGVR
VAAVTGFPSGKHVSSVKAHEAAAALASGASEIDMVIDIGAALCGDIDAVRSDIEAVRAAA
AGAVLKVIVESAVLLGQSNAHTLVDACRAAEDAGADFVKTSTGCHPAGGATVRAVELMAE
TVGPRLGVKASGGIRTAADAVAMLNAGATRLGLSGTRAVLDGLS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggccaaccgactcgggcgcagttggccgcgctggtagaccacaccctgctcaag
cctgagaccacccgtgccgatgtggccgcgctggtcgccgaagccgccgaactcggcgtc
tacgcggtctgcgtgtcgccgtcgatggtgccagttgcggtccaagccggtggtgtgcgg
gttgcggcggtgacgggcttcccgtcgggcaagcacgtgtcctcggtcaaggcgcatgag
gcggctgcggccctggcatccggcgccagtgagatcgacatggtcatcgacatcggggct
gcgctgtgcggtgacatcgacgcagtgcgctccgacatcgaggcggtgcgtgccgctgcg
gccggggctgtgctcaaggtgatcgtggagtcggcggtgctgttgggacagtcaaacgcg
cacacgttggtggatgcgtgtcgtgccgccgaggatgccggtgccgacttcgtcaaaacc
tcgactgggtgtcatccggccggcggggccacggtgcgtgccgtcgagctgatggccgag
acggtcggccctcggctaggggtcaaagccagcggtgggatccgcaccgccgccgacgcg
gtcgcgatgctcaacgccggtgccaccaggttgggcctgtccggcacccgggcggtgctc
gatgggctcagctga

DBGET integrated database retrieval system