KEGG   Mycobacterium tuberculosis H37Rv: Rv0482Help
Entry
Rv0482            CDS       T00015                                 

Gene name
murB
Definition
(RefSeq) UDP-N-acetylenolpyruvoylglucosamine reductase
  KO
K00075  
UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rv0482 (murB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rv0482 (murB)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     Rv0482 (murB)
Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Rv0482 (murB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
570539..571648
Genome map
AA seq 369 aa AA seqDB search
MKRSGVGSLFAGAHIAEAVPLAPLTTLRVGPIARRVITCTSAEQVVAALRHLDSAAKTGA
DRPLVFAGGSNLVIAENLTDLTVVRLANSGITIDGNLVRAEAGAVFDDVVVRAIEQGLGG
LECLSGIPGSAGATPVQNVGAYGAEVSDTITRVRLLDRCTGEVRWVSARDLRFGYRTSVL
KHADGLAVPTVVLEVEFALDPSGRSAPLRYGELIAALNATSGERADPQAVREAVLALRAR
KGMVLDPTDHDTWSVGSFFTNPVVTQDVYERLAGDAATRKDGPVPHYPAPDGVKLAAGWL
VERAGFGKGYPDAGAAPCRLSTKHALALTNRGGATAEDVVTLARAVRDGVHDVFGITLKP
EPVLIGCML
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggagcggtgtcggttcgctctttgccggtgcgcatattgccgaggcggtcccg
ttggcgccgctgaccactttgcgtgtgggcccgatcgcccgacgtgtcatcacttgcacc
agcgccgaacaggtggtggctgcgctgcggcacctggattcggcggccaagaccggagct
gaccgcccgctggtgtttgctggtggctccaatttggtgatcgccgagaacctgaccgac
ctgaccgtggtgcggttggccaatagcggcatcaccatcgacggtaacttggtgcgggcc
gaggccggtgcggtcttcgatgacgtggtggttagggccatcgaacagggtctgggcgga
ctggaatgcctgtctggcatcccaggatcggccggggcgacacccgtgcagaacgtgggg
gcgtatggcgcggaggtgtctgacaccatcactcgggttcggcttttggatcggtgcacg
ggtgaggtgcgttgggtatccgcgcgcgacctgcgcttcggctatcgcacgagcgtgctc
aaacacgctgatgggcttgcggtgcccaccgtggtcttggaggtggagtttgcgctggat
ccgtcgggccgcagcgcaccgctgcgctacggcgagctgatcgccgcgctgaatgcgacc
agcggcgagcgcgccgacccgcaagcggtccgcgaagcggtgctggccctgcgggcacgc
aagggcatggtgctggacccgaccgaccatgacacctggagcgtgggatcgttcttcaca
aacccggtggtcacccaggatgtttacgaacggctggccggtgacgcggccaccagaaag
gacggtccggtcccgcactatcccgcgcccgacggcgtcaagctggccgccggctggctg
gtggaacgggccggcttcggcaagggctatccggatgccggcgccgccccatgccggctt
tccaccaaacatgcgctggcgctgacaaatcgtggcggggccaccgccgaagatgtggtg
acgctggcgcgcgccgtgcgcgatggggtccatgatgtgtttggtatcacactaaaaccc
gaacccgtgctgatcggctgcatgttgtag

DBGET integrated database retrieval system