KEGG   Mycobacterium tuberculosis H37Rv: Rv0486Help
Entry
Rv0486            CDS       T00015                                 

Gene name
mshA
Definition
(RefSeq) D-inositol 3-phosphate glycosyltransferase
  KO
K15521  
D-inositol-3-phosphate glycosyltransferase [EC:2.4.1.250]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.250  D-inositol-3-phosphate glycosyltransferase
     Rv0486 (mshA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
575348..576790
Genome map
AA seq 480 aa AA seqDB search
MAGVRHDDGSGLIAQRRPVRGEGATRSRGPSGPSNRNVSAADDPRRVALLAVHTSPLAQP
GTGDAGGMNVYMLQSALHLARRGIEVEIFTRATASADPPVVRVAPGVLVRNVVAGPFEGL
DKYDLPTQLCAFAAGVLRAEAVHEPGYYDIVHSHYWLSGQVGWLARDRWAVPLVHTAHTL
AAVKNAALADGDGPEPPLRTVGEQQVVDEADRLIVNTDDEARQVISLHGADPARIDVVHP
GVDLDVFRPGDRRAARAALGLPVDERVVAFVGRIQPLKAPDIVLRAAAKLPGVRIIVAGG
PSGSGLASPDGLVRLADELGISARVTFLPPQSHTDLATLFRAADLVAVPSYSESFGLVAV
EAQACGTPVVAAAVGGLPVAVRDGITGTLVSGHEVGQWADAIDHLLRLCAGPRGRVMSRA
AARHAATFSWENTTDALLASYRRAIGEYNAERQRRGGEVISDLVAVGKPRHWTPRRGVGA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgtgcggcacgatgacggttcagggttgatcgcccagcgccgtccggtccgc
ggcgagggtgccacccgctcgcgcggcccatccgggccatccaatcggaatgtttcggca
gcagacgacccgcgccgggttgcgctgctggcggtgcacacctcaccgctggcacagccg
ggcaccggtgacgccggcggcatgaacgtctacatgctgcaaagtgcgctgcacctggcc
cgtcggggcatcgaggtggagatcttcacccgggccaccgcatcggcagatccaccggtg
gtgcgggtggcacccggggtgctggtgcgcaacgtggtggcggggcccttcgagggtttg
gacaagtacgacctgcccacccagctttgtgcgttcgccgccggggtgctgcgcgccgag
gcggtccacgaaccgggttactacgacatcgtgcactcgcactactggctgtcgggtcag
gtcggctggctggcgcgcgaccgctgggcggtgccgttggtgcacaccgcacacacgctg
gccgccgtgaagaacgcggcactggccgacggcgacggacccgagccgccgctgcgtacg
gtcggggagcagcaggtcgtcgacgaggcggatcggttgatcgtcaacaccgacgatgaa
gccaggcaagtgatttcgcttcatggtgccgatccggcacgaatcgacgtggtccatccc
ggtgtcgatctggacgtgttccgcccgggtgatcggcgcgcggcccgggccgcgctagga
ctaccagttgacgagcgcgtggtggccttcgtcggacgcatccagccgctgaaggcaccc
gacattgtgctgcgtgcggccgccaagttgcccggggtgcgcatcatcgtggccggcgga
ccgtcgggcagcggtctggcttcaccggacggactggtccggctcgccgacgaactgggc
atctctgcacgggtgacgtttctgccgccgcagtcccacacggatctggccaccttgttt
cgggcggcggacctggttgcggtgccgagctactccgagtcgttcggcctggttgctgtg
gaggcccaagcgtgcggcacaccggtggtggccgcggcggtgggcgggctgcccgtcgcg
gtgcgcgacgggatcaccggcaccctggtgtccgggcacgaggtcggtcagtgggccgac
gccatcgatcacctgctgcggttgtgtgccgggccacggggacgggtgatgagccgggcg
gcggcacggcacgccgccacgttctcgtgggagaacaccaccgacgcgctgttggccagt
tatcggcgtgcgatcggcgagtacaacgccgagcgccagcgccggggcggcgaggtgata
tcggacctggtagcggtgggcaagccccgccactggacgccgcgtcgcggggtgggcgcg
tga

DBGET integrated database retrieval system