KEGG   Mycobacterium tuberculosis H37Rv: Rv0524Help
Entry
Rv0524            CDS       T00015                                 

Gene name
hemL
Definition
(RefSeq) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  
glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv0524 (hemL)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Rv0524 (hemL)
Amino acid related enzymes [BR:mtu01007]
 Aminotransferase (transaminase)
  Class III
   Rv0524 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
614835..616223
Genome map
AA seq 462 aa AA seqDB search
MGSTEQATSRVRGAARTSAQLFEAACSVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLID
ADGNRYVDLVCSWGPMILGHAHPAVVEAVAKAAARGLSFGAPTPAETQLAGEIIGRVAPV
ERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALLADAGSGVATLGLCDDP
QRPASPRSQSSRGLPSSPGVTGAAAADTIVLPYNDIDAVQQTFARFGEQIAAVITEASPG
NMGVVPPGPGFNAALRAITAEHGALLILDEVMTGFRVSRSGWYGIDPVPADLFAFGKVMS
GGMPAAAFGGRAEVMQRLAPLGPVYQAGTLSGNPVAVAAGLATLRAADDAVYTALDANAD
RLAGLLSEALTDAVVPHQISRAGNMLSVFFGETPVTDFASARASQTWRYPAFFHAMLDAG
VYPPCSAFEAWFVSAALDDAAFGRIANALPAAARAAAQERPA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcacggaacaggccacctcgcgggtaaggggagccgcgcgcacatcggcgcag
ctgttcgaggccgcatgcagcgtcatacccggcggagtgaactccccggtgcgggcgttc
acggcggtgggcggcaccccgcgcttcattaccgaagcccacggctgctggttgattgac
gccgacggcaaccgctacgtagacctggtctgctcatggggcccgatgatcctcggtcac
gcgcatccggccgtcgtcgaggcagtggccaaggccgcagcccgcggcctgtccttcggg
gccccgactcccgccgaaacccaactagccggcgagatcatcggccgggtagctcccgtc
gagcggatacggctggtgaactccggcaccgaggccactatgagcgccgtgcggctggcc
cgcggattcaccggccgggccaagatcgtcaagttctccggctgctaccacggacacgtc
gacgcattgctcgccgacgcgggttcgggagtggccaccctgggcttatgtgacgacccc
cagcgcccggcttcgccgcgctcgcaatcgtcacggggcctgccgtcctcccccggggtc
actggcgccgcggcagccgacacgatcgtgttgccctacaacgacatcgatgccgtacag
cagaccttcgcccggttcggcgagcagatcgccgccgtaatcaccgaggccagccccggc
aacatgggagtcgtcccgcccgggcccggcttcaacgcggcgctgcgcgcgatcaccgcc
gagcacggcgccctgctcatcctcgacgaggtgatgaccgggttccgggtcagccgaagt
ggttggtacggaatcgatccggtgcccgctgacctgttcgccttcggcaaggtgatgagc
ggcgggatgcccgccgccgcgttcggcgggcgcgccgaggtgatgcagcggctggcgccg
ctggggccggtgtatcaggccggcacgttgtcgggtaacccggtggcggttgccgccggg
ctggcaacgctgcgggccgccgacgacgcggtctacaccgcattggacgccaacgctgac
cgcctggccggcctgctctccgaggcactgacggatgccgttgtgccacaccagatttcg
cgggcaggcaatatgctcagtgtgttcttcggcgaaacaccggtgaccgacttcgcgtcc
gcgcgggccagccagacctggcgttatccagcgttctttcatgccatgctggacgccggt
gtctacccgccgtgcagtgccttcgaggcatggttcgtctcggccgctttggacgacgcg
gcgttcggccggatcgccaacgcgctgcccgccgcggcccgagcggcggcccaggaaagg
cccgcctga

DBGET integrated database retrieval system