KEGG   Mycobacterium tuberculosis H37Rv: Rv0534cHelp
Entry
Rv0534c           CDS       T00015                                 

Gene name
menA
Definition
(RefSeq) 1,4-dihydroxy-2-naphthoate octaprenyltransferase
  KO
K02548  
1,4-dihydroxy-2-naphthoate octaprenyltransferase [EC:2.5.1.74 2.5.1.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Rv0534c (menA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.74  1,4-dihydroxy-2-naphthoate polyprenyltransferase
     Rv0534c (menA)
    2.5.1.-  
     Rv0534c (menA)
Prenyltransferases [BR:mtu01006]
 Compound prenylation
  DHNA octaprenyltransferase
   Rv0534c (menA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(625562..626440)
Genome map
AA seq 292 aa AA seqDB search
MASFAQWVSGARPRTLPNAIAPVVAGTGAAAWLHAAVWWKALLALAVAVALVIGVNYAND
YSDGIRGTDDDRVGPVRLVGSRLATPRSVLTAAMTSLALGALAGLVLALLSAPWLIAVGA
ICIAGAWLYTGGSKPYGYAGFGELAVFVFFGPVAVLGTQYTQALRVDWVGLAQAVATGAL
SCSVLVANNLRDIPTDARADKITLAVRLGDARTRMLYQGLLAVAGVLTFVLMLATPWCVV
GLVAAPLALRAAGPVRSGRGGRELIPVLRDTGLAMLVWALAVAGALAFGQLS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtggccagtttcgcacagtgggtctccggcgcgcggccccgaacgctgccgaacgcgatc
gcgccagtggttgccggcaccggcgccgcggcctggctgcacgcggccgtgtggtggaaa
gcgctgttggcactggctgttgcggtggcgctggtcattggggtcaattacgccaatgac
tactccgacggcatccgcggcaccgatgacgacagggtgggtccggtgcggttggtgggc
tcgcggctggcgaccccgcgctcggtgctgaccgctgccatgacgagcctggcgctcggt
gcgctggccgggctggttttggcgctgctcagcgcgccgtggctgattgcggtgggtgcg
atctgcatcgccggggcctggctctacaccggcgggtcaaaaccctacggctatgcgggc
ttcggcgaactggcggtgtttgtgttcttcgggccggtcgccgtgctcggtacccagtac
acgcaggcattgcgggtggactgggtggggctggcacaggcggtagcaacgggtgcgttg
tcgtgctcggtgctggtggccaacaacctgcgcgacatccccaccgacgcgcgggccgac
aagatcacgctggcggtgcggctgggagacgcccggacccggatgctttaccagggcctg
ctggcggtcgccggggtgctgacgttcgtgctaatgctggccacgccgtggtgtgtggtg
ggcttggtggccgcgcctttggcgctgcgcgctgccggaccggtgcgatccgggcgcggc
gggcgcgagctgatcccggtactgcgtgacactgggctggccatgctggtgtgggcgttg
gcggtggcgggggcattggcgtttggtcagttgagctaa

DBGET integrated database retrieval system