KEGG   Mycobacterium tuberculosis H37Rv: Rv0535Help
Entry
Rv0535            CDS       T00015                                 

Definition
(RefSeq) 5'-methylthioadenosine phosphorylase
  KO
K00772  
5'-methylthioadenosine phosphorylase [EC:2.4.2.28]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv0535
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.28  S-methyl-5'-thioadenosine phosphorylase
     Rv0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
626457..627251
Genome map
AA seq 264 aa AA seqDB search
MHNNGRMLGVIGGSGFYTFFGSDTRTVNSDTPYGQPSAPITIGTIGVHDVAFLPRHGAHH
QYSAHAVPYRANMWALRALGVRRVFGPCAVGSLDPELEPGAVVVPDQLVDRTSGRADTYF
DFGGVHAAFADPYCPTLRAAVTGLPGVVDGGTMVVIQGPRFSTRAESQWFAAAGCNLVNM
TGYPEAVLARELELCYAAIALVTDVDAGVAAGDGVKAADVFAAFGENIELLKRLVRAAID
RVADERTCTHCQHHAGVPLPFELP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacaatgggcgcatgctcggagtgatcggcggcagcggcttctacaccttcttt
gggtcggacacccgcacagtcaattcggacaccccctacggtcaacccagcgccccgatc
acgatcggcaccatcggggtgcacgacgtcgcgttcttgccccgccacggcgcccatcac
cagtactcggcgcacgccgtgccgtatcgggccaacatgtgggcgctgcgcgcgcttggt
gtgcggcgggtcttcgggccgtgtgcggtcggcagcctggaccctgaactcgagcccggc
gcggtcgtggtgcccgatcagctggtcgaccgcaccagcggccgcgccgacacctatttc
gacttcggcggtgtccatgccgccttcgccgatccgtactgccccacgctgcgggccgcg
gtgaccggcctgcccggtgttgtcgacggcggcaccatggtggtgatccagggtccgcgg
ttttccacccgcgcggaaagccagtggttcgccgctgccgggtgcaatctggtcaacatg
accggctatcccgaggcggtgctggctcgcgaactcgaattatgctacgcagcaatcgct
ttggtgacagatgtggatgccggcgtcgctgctggcgatggcgtgaaagccgccgacgtg
ttcgccgcattcggggagaacatcgaactgctcaaaaggctggtgcgggccgccatcgat
cgggtcgccgacgagcgcacgtgcacgcactgtcaacaccacgccggtgttccgttgccg
ttcgagctgccatga

DBGET integrated database retrieval system