KEGG   Mycobacterium tuberculosis H37Rv: Rv0542cHelp
Entry
Rv0542c           CDS       T00015                                 

Gene name
menE
Definition
(RefSeq) 2-succinylbenzoic acid--CoA ligase
  KO
K01911  
O-succinylbenzoic acid--CoA ligase [EC:6.2.1.26]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Rv0542c (menE)
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.26  o-succinylbenzoate---CoA ligase
     Rv0542c (menE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(634416..635504)
Genome map
AA seq 362 aa AA seqDB search
MLGGSDPALVAVPTQHESLLGALRVGEQIDDDVALVVTTSGTTGPPKGAMLTAAALTASA
SAAHDRLGGPGSWLLAVPPYHIAGLAVLVRSVIAGSVPVELNVSAGFDVTELPNAIKRLG
SGRRYTSLVAAQLAKALTDPAATAALAELDAVLIGGGPAPRPILDAAAAAGITVVRTYGM
SETSGGCVYDGVPLDGVRLRVLAGGRIAIGGATLAKGYRNPVSPDPFAEPGWFHTDDLGA
LESGDSGVLTVLGRADEAISTGGFTVLPQPVEAALGTHPAVRDCAVFGLADDRLGQRVVA
AIVVGDGCPPPTLEALRAHVARTLDVTAAPRELHVVNVLPRRGIGKVDRAALVRRFAGEA
DQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgctgggtggcagcgacccggcattggtcgcggtgcccacccagcatgagtccttgctg
ggcgctttgcgagtgggcgagcagattgacgacgacgtcgccctggtagtgacgacgtca
ggaaccacgggaccgcccaagggcgccatgttgaccgcggcggccttgaccgccagcgcc
tcggccgcccacgaccggctcggcggaccgggcagctggctgttggctgtgccgccgtat
cacatcgccgggctggcggtgctggtgcgcagcgtgatcgccggatcagttcctgtcgaa
ctgaacgtctccgcgggattcgatgtcaccgaattacccaacgcgataaagagattgggt
tctggccggcgatacacgtcgctggtcgccgcacagttggccaaggcacttaccgacccg
gcggccacggccgcgctggccgaattggacgcggtgctgatcggcggcgggccggccccc
cggcccatcctggacgccgcggccgccgccggcatcacggtggtgcgcacctacggcatg
agcgagacctcgggcggctgtgtctacgacggcgttccgctcgacggggtccggctgagg
gtgctggccggcggccgcatagctatcggcggtgcgaccctggccaagggctatcgcaac
ccggtctcgcccgatccgttcgccgagccaggctggtttcacaccgacgaccttggcgcc
cttgaatcgggtgattcgggtgtgctgaccgtgctgggccgagccgacgaagcgatcagc
acgggcggattcaccgtgctgccgcagccagtggaggccgcactgggcacccaccctgcg
gtgcgtgactgcgcggtttttggacttgccgacgaccgactcggtcagcgagtggtcgcc
gcgattgtggtcggcgacggatgcccaccaccaacgctagaagcgctgcgggcgcatgtc
gcgcgcaccctggacgtcaccgccgcgccccgagagctacatgtcgtgaacgtgctaccg
cgacgcggcatcggcaaggtggaccgggcagcgttggtgcgccggttcgccggtgaagcc
gatcaatag

DBGET integrated database retrieval system