KEGG   Mycobacterium tuberculosis H37Rv: Rv0555Help
Entry
Rv0555            CDS       T00015                                 

Gene name
menD
Definition
(RefSeq) bifunctional 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase/2-oxoglutarate decarboxylase
  KO
K02551  
2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC:2.2.1.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Rv0555 (menD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     Rv0555 (menD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
646298..647962
Genome map
AA seq 554 aa AA seqDB search
MNPSTTQARVVVDELIRGGVRDVVLCPGSRNAPLAFALQDADRSGRIRLHVRIDERTAGY
LAIGLAIGAGAPVCVAMTSGTAVANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTM
EQLGYFGTQVRASISLGLAEDAPERTSALNATWRSATCRVLAAATGARTANAGPVHFDIP
LREPLVPDPEPLGAVTPPGRPAGKPWTYTPPVTFDQPLDIDLSVDTVVISGHGAGVHPNL
AALPTVAEPTAPRSGDNPLHPLALPLLRPQQVIMLGRPTLHRPVSVLLADAEVPVFALTT
GPRWPDVSGNSQATGTRAVTTGAPRPAWLDRCAAMNRHAIAAVREQLAAHPLTTGLHVAA
AVSHALRPGDQLVLGASNPVRDVALAGLDTRGIRVRSNRGVAGIDGTVSTAIGAALAYEG
AHERTGSPDSPPRTIALIGDLTFVHDSSGLLIGPTEPIPRSLTIVVSNDNGGGIFELLEQ
GDPRFSDVSSRIFGTPHDVDVGALCRAYHVESRQIEVDELGPTLDQPGAGMRVLEVKADR
SSLRQLHAAIKAAL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccctcgacgacacaggcgcgcgtcgtcgtcgacgaactgatccgcggcggcgtt
cgcgacgtggtgctgtgtccgggctcgcgcaatgcgccgctggccttcgcgctgcaggac
gccgaccggtccggccggatccggttgcacgttcgcatcgatgaacgcaccgccggctac
ctggccatcgggctggcaatcggggcgggcgcgccggtgtgtgtcgcgatgacatccggc
accgccgtggccaacctcggtccggcggtggtggaggcaaactacgctcgggtgccgctg
atcgtgctgtcagccaatcggccctacgagctgctgggcaccggcgccaaccagaccatg
gaacagctgggctatttcggcacccaggtgcgcgccagcatcagcctggggctggccgag
gacgcacccgagcggacctcggcgctcaacgcgacctggcgatcggctacgtgccgagtg
ttggcggccgccacgggtgctcgcaccgccaacgcgggccccgtgcacttcgacatcccg
ctgcgcgaaccgctggtgcccgatcccgagcccctcggcgcggtcaccccgccgggccgg
cctgctggcaagccgtggacctacacgccgccggtcaccttcgaccagccactggacatc
gacctgtcggtcgacaccgtggtcatctccgggcatggcgctggcgtgcaccccaacctc
gcggcgttgccgaccgtcgcagaaccgacggcgccgcggtccggggacaacccgttgcac
ccgctggcgctgccgctgctgcgccctcaacaggtgatcatgctgggccggccgacactg
catcgtccggtatcggtgctgctggccgacgcagaagtgccggtattcgcattgacaacc
ggtccacgctggccggatgtctcgggtaactcgcaggccaccggcacgcgggcggtcacc
accggcgcgccgcggcccgcgtggctggaccggtgtgcggcgatgaaccggcacgcgatc
gcggcggttcgggaacagctcgcggcgcacccgttgaccaccgggctgcatgtcgcggcg
gcggtgtcgcatgcgctgcggcccggtgaccagctggtgctcggggcatccaatccggtg
cgggatgtggcgttggccggtttggacacccgcggcatccgggtacggtccaaccgtggg
gtcgccggcatcgacggcaccgtgtccaccgcgatcggggcggccctagcttatgagggg
gctcacgagcgcaccggcagcccggactccccgccccgcaccatcgcactgatcggcgac
ctgacgttcgtgcacgacagctccgggctgttgatcgggccgaccgaaccgataccgcgg
tcattgaccatcgtggtgtctaatgacaacggcggcggcatcttcgaattgctcgagcag
ggtgatcccaggttctccgacgtgtcatcgcgaatcttcggcaccccacacgacgtcgat
gtgggcgcattgtgccgcgcctaccacgtggaatctcgccagatcgaggtcgacgaactc
ggaccgaccctcgatcaacccggtgccggcatgcgcgtgctcgaggtcaaggccgaccgg
tcgtcgttgcgacaattgcacgccgccatcaaggcggctctgtga

DBGET integrated database retrieval system