KEGG   Mycobacterium tuberculosis H37Rv: Rv0557Help
Entry
Rv0557            CDS       T00015                                 

Gene name
mgtA
Definition
(RefSeq) GDP-mannose-dependent alpha-mannosyltransferase
  KO
K12583  
phosphatidylinositol alpha 1,6-mannosyltransferase [EC:2.4.1.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     Rv0557 (mgtA)
Glycosyltransferases [BR:mtu01003]
 Glycan extension
  Glycolipid
   Rv0557 (mgtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
648536..649672
Genome map
AA seq 378 aa AA seqDB search
MCGVRVAIVAESFLPQVNGVSNSVVKVLEHLRRTGHEALVIAPDTPPGEDRAERLHDGVR
VHRVPSRMFPKVTTLPLGVPTFRMLRALRGFDPDVVHLASPALLGYGGLHAARRLGVPTV
AVYQTDVPGFASSYGIPMTARAAWAWFRHLHRLADRTLAPSTATMESLIAQGIPRVHRWA
RGVDVQRFAPSARNEVLRRRWSPDGKPIVGFVGRLAPEKHVDRLTGLAASGAVRLVIVGD
GIDRARLQSAMPTAVFTGARYGKELAEAYASMDVFVHSGEHETFCQVVQEALASGLPVIA
PDAGGPRDLITPHRTGLLLPVGEFEHRLPDAVAHLVHERQRYALAARRSVLGRSWPVVCD
ELLGHYEAVRGRRTTQAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggcgtgcgcgttgcgatcgtcgccgagtcgttcctcccgcaggtgaacggcgtc
agcaactcggtggtcaaggtactcgaacatctgcgtcgaaccggtcatgaagccctggtg
atcgcgcccgacacgccgccaggtgaagaccgcgccgagcgacttcacgacggtgtccgg
gtgcaccgggtgccgtcgcggatgttcccaaaggtgaccacgttgccgctcggcgtgccc
accttccgaatgctgagagcgctgcgcggattcgatccggatgtcgtgcatctggcgtcg
ccggcgctgcttggctacggtggactccatgccgctcggcggctaggggtgcccacggtc
gcggtctaccaaaccgatgttccgggtttcgcgtccagctacggcattccgatgacagca
cgggcggcgtgggcatggttccgccacttgcatcgcctggctgaccgcactctggcgccg
tccacagcgacaatggaatcccttattgcccagggcattccgcgagtacaccggtgggca
cgcggggtggacgtgcaacgtttcgcgccgtcggcgcgaaacgaggtgttgaggcgacgg
tggtcaccggacggcaaacccatcgtcggctttgtgggtcggcttgctccggagaagcat
gtcgaccggctcacgggtctggcggcctccggcgccgtgcggctggtgatcgtcggcgac
ggcatcgaccgggcaagattgcaatcagcaatgcccacagcggttttcaccggagcacgg
tatggcaaagagctcgccgaggcgtatgccagcatggacgtcttcgtacattccggtgag
cacgagacgttctgccaagtcgtgcaggaagcgctggcgtcggggctaccggtgatcgct
ccggacgccggcggaccgcgtgatctgataaccccgcaccgcaccgggctgctgttgccg
gtcggcgagttcgagcaccggcttcctgacgccgtcgcccacctggtgcacgaacgccag
cgctacgcgctggccgcccggcgcagtgtgctgggccgcagttggccggtggtctgcgat
gagctgctcggccactacgaggcggtgcgaggtcggcgcacgacccaggccgcgtaa

DBGET integrated database retrieval system