KEGG   Mycobacterium tuberculosis H37Rv: Rv0562Help
Entry
Rv0562            CDS       T00015                                 

Gene name
grcC1
Definition
(RefSeq) polyprenyl-diphosphate synthase GrcC
  KO
K00805  
heptaprenyl diphosphate synthase [EC:2.5.1.30]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Terpenoid backbone biosynthesis
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rv0562 (grcC1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.30  heptaprenyl diphosphate synthase
     Rv0562 (grcC1)
Prenyltransferases [BR:mtu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Rv0562 (grcC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
652771..653778
Genome map
AA seq 335 aa AA seqDB search
MRTPATVVAGVDLGDAVFAAAVRAGVARVEQLMDTELRQADEVMSDSLLHLFNAGGKRFR
PLFTVLSAQIGPQPDAAAVTVAGAVIEMIHLATLYHDDVMDEAQVRRGAPSANAQWGNNV
AILAGDYLLATASRLVARLGPEAVRIIADTFAQLVTGQMRETRGTSENVDSIEQYLKVVQ
EKTGSLIGAAGRLGGMFSGATDEQVERLSRLGGVVGTAFQIADDIIDIDSESDESGKLPG
TDVREGVHTLPMLYALRESGPDCARLRALLNGPVDDDAEVREALTLLRASPGMARAKDVL
AQYAAQARHELALLPDVPGRRALAALVDYTVSRHG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgaggactccggcgacggtggtggcaggcgttgacctgggcgacgctgtctttgccgcg
gccgtgcgtgctggtgtcgcgcgagtcgagcaactcatggacaccgagctgcgccaggcc
gacgaggtgatgagcgattcgctgctgcacttgttcaatgccggcggcaagcggttccgt
ccactgttcaccgtgctgtcggcgcagatcgggccgcagccggatgccgcagcggtgaca
gtcgccggggcggtgatcgagatgatccacctggcgaccctctaccacgatgacgtgatg
gacgaggcccaggtccgccgcggcgcgcccagcgccaacgcgcaatggggtaacaacgtc
gcgatcctggctggcgactacctactggccaccgcatcgcggctggtggcgaggttggga
ccggaggcggtgcggatcatcgccgacaccttcgcccagttggtgaccgggcagatgcgt
gagacgcgcggcacgtcggagaacgtggactccatcgagcagtacctgaaggtggtccag
gagaagaccggcagtctaatcggggcggccggccggctgggtgggatgttctccggtgcc
accgacgaacaggtcgaacggctgagccgcctcggcggcgtggtgggcaccgcgtttcag
atcgccgacgacattatcgacatcgacagcgagtctgacgagtcgggcaagctgcccggt
accgatgtgcgcgaaggagtacacaccctgccgatgctctacgcgttacgggaatcaggg
cccgattgcgctcggttgcgcgcactgctgaacggaccggtcgacgacgacgccgaggtg
cgcgaggcgctgacattgttgcgggcgtcgccgggcatggcccgggccaaagacgtcctg
gcgcagtacgcggctcaggcacgtcacgagctggccttactgcccgacgtcccgggacgg
cgtgccctggcggcgctggtcgactacaccgtgagccggcacggctag

DBGET integrated database retrieval system