KEGG   Mycobacterium tuberculosis H37Rv: Rv0573cHelp
Entry
Rv0573c           CDS       T00015                                 

Gene name
pncB2
Definition
(RefSeq) nicotinic acid phosphoribosyltransferase PncB2
  KO
K00763  
nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv0573c (pncB2)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     Rv0573c (pncB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(665851..667242)
Genome map
AA seq 463 aa AA seqDB search
MAIRQHVGALFTDLYEVTMAQAYWAERMSGTAVFEIFFRKLPPGRSYIMAAGLADVVEFL
EAFRFDEQDLRYLRGLGQFSDEFLRWLAGVRFTGDVWAAPEGTVIFPNEPAVQLIAPIIE
AQLVETFVLNQIHLQSVLASKAARVVAAARGRPVVDFGARRAHGTDAACKVARTSYLAGA
AGTSNLLAARQYGIPTFGTMAHSFVQAFDSEVAAFEAFARLYPATMLLVDTYDTLRGVDH
VIELAKRLGNRFDVRAVRLDSGDLDELSKATRARLDTAGLEQVEIFASSGLDENRIAALL
AARCPIDGFGVGTQLVVAQDAPALDMAYKLVAYDGSGRTKFSSGKVIYPGRKQVFRKLEH
GVFCGDTLGEHGENLPGDPLLVPIMTNGRRIRQHAPTLDGARDWARQQIDALPPELRSLE
DTGYSYPVAVSDRIVGELARLRHADTAEAHPGSNVVGAKAKRP
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcgatccgccaacacgtcggcgcgctgttcaccgacctgtacgaggtgacgatggcc
caggcctactgggccgaaagaatgtcgggcacagcggttttcgagatattcttccgcaag
cttccgcctggcaggtcctacatcatggccgccgggctggccgatgtggtcgagttcctc
gaagcgtttcgattcgacgagcaggatctgcgttacctgcgtggcctgggccagttttcc
gacgagttcctgaggtggctggccggagtgcgtttcaccggagatgtctgggccgcgccg
gaaggaaccgtgatttttccgaacgaacccgcggtccagctgatcgcgccaatcatcgag
gcccagcttgtcgagacgtttgtgctgaaccagattcatctgcaaagcgtgctcgcgagc
aaggccgcgcgggtggtcgccgccgcgcgcggacgaccggtggtggatttcggcgcgcgg
cgcgctcacggcaccgacgcggcctgcaaggtcgcgcgcaccagttatctcgcgggcgct
gcgggcacgtcgaatctgctcgcggcccgccaatatgggatcccgacgttcggcaccatg
gcgcacagctttgttcaagccttcgacagtgaggtggccgcgttcgaggcgttcgcccgg
ctctacccagccaccatgctgctcgtggacacctacgacacgctacgcggcgtcgatcac
gtcatcgagttggccaagcggctgggcaatcgcttcgatgtgcgcgcggtccggctggat
tccggcgacctcgatgagctgtccaaggcgacccgtgcacggctcgacaccgccggtctc
gagcaggtcgagatcttcgcgtcgtcgggcctcgacgaaaaccgcatcgccgcgcttttg
gctgcccgctgtccgatcgacggcttcggcgtgggcacccagctcgtcgtggctcaagac
gcgcccgcgctggacatggcctacaagctggtggcatacgacggcagcgggcgcaccaag
ttctccagcggcaaggtgatctacccgggacgcaagcaggtgttccgtaagctcgagcac
ggagtcttttgcggcgacacgctcggcgagcacggtgaaaaccttcccggggacccgttg
ctggtgcccatcatgaccaacggccgacgcatccggcagcatgcacccacattggacggc
gcgcgggactgggcccgccagcagatcgacgcgctcccgccggagctgcgctcgctcgag
gacaccggctactcgtatccggtggcggtcagcgacaggatcgtgggcgaactcgcccgg
ctgcggcacgccgacacggccgaagcccaccccgggtccaacgtcgtcggggcgaaggcc
aaacgaccctag

DBGET integrated database retrieval system