KEGG   Mycobacterium tuberculosis H37Rv: Rv0635Help
Entry
Rv0635            CDS       T00015                                 

Gene name
hadA
Definition
(RefSeq) (3R)-hydroxyacyl-ACP dehydratase subunit HadA
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
731930..732406
Genome map
AA seq 158 aa AA seqDB search
MALSADIVGMHYRYPDHYEVEREKIREYAVAVQNDDAWYFEEDGAAELGYKGLLAPLTFI
CVFGYKAQAAFFKHANIATAEAQIVQVDQVLKFEKPIVAGDKLYCDVYVDSVREAHGTQI
IVTKNIVTNEEGDLVQETYTTLAGRAGEDGEGFSDGAA
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtggcgttgagcgcagacatcgttgggatgcattaccggtatcccgaccactacgaggtg
gagcgggagaagattcgcgagtacgccgtcgccgttcaaaacgacgacgcgtggtatttc
gaggaggacggcgccgccgaactcgggtataagggcttgctggctccgttgacgtttatc
tgtgtgttcggctacaaggcccaggcggcgttcttcaagcatgcgaacatcgcgaccgcg
gaggcgcagatcgtccaggtagaccaagtgctgaaattcgagaaaccgatcgtggcgggc
gacaagctgtactgcgacgtctatgtggattcggtgcgtgaggcgcacggcacccagatc
atcgtgaccaagaacatcgtcaccaacgaggaaggtgacctcgtgcaggagacctatacg
accctggcgggccgtgccggcgaggatggagagggattttctgatggcgctgcgtga

DBGET integrated database retrieval system