KEGG   Mycobacterium tuberculosis H37Rv: Rv0644cHelp
Entry
Rv0644c           CDS       T00015                                 

Gene name
mmaA2
Definition
(RefSeq) cyclopropane mycolic acid synthase CmaA
  KO
K00574  
cyclopropane-fatty-acyl-phospholipid synthase [EC:2.1.1.79]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.79  cyclopropane-fatty-acyl-phospholipid synthase
     Rv0644c (mmaA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(738297..739160)
Genome map
AA seq 287 aa AA seqDB search
MVNDLTPHFEDVQAHYDLSDDFFRLFLDPTQTYSCAHFEREDMTLEEAQIAKIDLALGKL
GLQPGMTLLDIGCGWGATMRRAIAQYDVNVVGLTLSKNQAAHVQKSFDEMDTPRDRRVLL
AGWEQFNEPVDRIVSIGAFEHFGHDRHADFFARAHKILPPDGVLLLHTITGLTRQQMVDH
GLPLTLWLARFLKFIATEIFPGGQPPTIEMVEEQSAKTGFTLTRRQSLQPHYARTLDLWA
EALQEHKSEAIAIQSEEVYERYMKYLTGCAKLFRVGYIDVNQFTLAK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacgacctaacgccgcacttcgaggacgtgcaggcacactacgacctgtccgac
gacttcttccggctgttcctggatccgacccagacctacagctgcgcgcatttcgaacgc
gaggacatgacgctggaagaggcccagatcgccaagatcgacctggcgctgggcaagcta
ggtctgcagcccggcatgacgctgctcgatatcggttgcggctggggcgccaccatgcgg
cgcgcgatcgcgcagtatgacgtcaacgtcgtcggcctgacattgtcgaagaaccaggcc
gcccatgtgcagaagtcgttcgacgagatggacaccccgcgcgacaggcgagtgttgctg
gcgggatgggagcagttcaacgagcccgtcgaccgcatcgtgtcgatcggcgcgttcgag
cacttcggccacgatcgtcacgccgacttcttcgcccgggcccacaaaatcctgccgccc
gatggcgtgttgctgctgcacacgatcaccggcctgaccaggcagcagatggtcgaccac
ggcttgccgctcacgttgtggctggcccgctttctcaagttcatcgcgaccgaaatcttc
ccggggggccaacctccgacgattgaaatggttgaggaacagtcggcgaagacgggtttc
acgctgactcgccgccagtcgctgcagccgcattacgccaggaccctcgacctgtgggcc
gaggcgctgcaggaacacaaaagcgaggccatcgcgatccagtccgaagaggtctacgag
cggtacatgaaatacctgaccggctgcgccaagctgttccgggtcggctacatcgacgtc
aaccagttcacgctggcgaagtag

DBGET integrated database retrieval system