KEGG   Mycobacterium tuberculosis H37Rv: Rv0728cHelp
Entry
Rv0728c           CDS       T00015                                 

Gene name
serA2
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase SerA
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00680  Methane metabolism
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Rv0728c (serA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv0728c (serA2)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Rv0728c (serA2)
    1.1.1.399  2-oxoglutarate reductase
     Rv0728c (serA2)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv0728c (serA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh
Motif
Other DBs
NCBI-GeneID: 888555
NCBI-ProteinID: NP_215242
TubercuList: Rv0728c
UniProt: I6WZ71 L0T7B7
Position
complement(820496..821476)
Genome map
AA seq 326 aa AA seqDB search
MTPRPRALVTAPLRGPGFAQLRRLADVVYDPWIDQRPLRIYSAEQLADRITAVAADVLVV
ESDSVGGPVFERGLRVVAATRGDPSNVDIPGATAAGIPVLHTPARNADAVAEMTVALLLA
VARHLIPADADVRSGNIFRDGTIPYQRFRGAEIAGLTAGLVGLGAVGRAVRWRLSGLGLR
VIAHDPYRDDAGHSLDELLAEADIVSMHAAVTDDTIGMIGAQQFAAMRDGAVFLNTARSQ
LRDTDALVDALRGGKLAAAGLDHFTGEWLPTDHPLVSMPNVVLTPHIGGATWNTEARQAR
MVADDLGALLSGNRPAHVVNPEVLGS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcctcgaccgcgtgctctggtgacggctccattgcgtggaccggggttcgcccag
ctccggcggctagccgacgtggtatacgacccgtggatcgatcagcgaccgctgcgaatc
tacagcgccgagcagctagctgaccggatcaccgccgtcgccgccgatgttcttgtggtg
gaaagtgactcggtcggtggcccggtgttcgagcgggggttgcgggtggtcgccgccacc
cgcggggatcccagcaacgtcgacatccccggcgccaccgcggccggcataccggtgctg
cacaccccggctcgcaacgccgacgctgtcgccgagatgacggtggccctgttgctggcc
gtcgcccggcacctgattcccgcggacgcagatgtgcggtccggcaacatctttcgcgac
ggcaccatcccctatcagcggttccgcggtgccgaaatcgccgggctgactgccgggctg
gtgggcctgggtgccgtcggtcgcgcggtgcgctggaggctgtccgggctgggcctgcgg
gtcatcgcgcacgatccttaccgcgacgacgccggccacagccttgacgagctgctggcc
gaggctgacatcgtctccatgcacgcggcggtcaccgacgacacgatcgggatgatcggt
gcccagcagttcgcggccatgcgcgacggtgcggtgtttctcaacaccgcccggtcccag
ctgcgcgacaccgatgcgctcgtcgacgccctgcgtggcggcaagctggccgccgccggc
ctggaccacttcaccggtgaatggctgccgaccgatcaccctttggtgagcatgcccaat
gtcgtcctcaccccccacatcggcggggccacctggaacaccgaggcccggcaggcgcgg
atggtcgccgacgacctgggcgcactgctgtccggcaacaggcccgcccatgtcgtcaac
ccggaggtattgggctcatga

DBGET integrated database retrieval system