KEGG   Mycobacterium tuberculosis H37Rv: Rv0733Help
Entry
Rv0733            CDS       T00015                                 

Gene name
adk
Definition
(RefSeq) adenylate kinase
  KO
K00939  
adenylate kinase [EC:2.7.4.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Thiamine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rv0733 (adk)
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rv0733 (adk)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     Rv0733 (adk)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv0733 (adk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
826122..826667
Genome map
AA seq 181 aa AA seqDB search
MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVP
SDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVL
LERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALG
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgagagttttgttgctgggaccgcccggggcgggcaaggggacgcaggcggtgaagctg
gccgagaagctcgggatcccgcagatctccaccggcgaactcttccggcgcaacatcgaa
gagggcaccaagctcggcgtggaagccaaacgctacttggatgccggtgacttggtgccg
tccgacttgaccaatgaactcgtcgacgaccggctgaacaatccggacgcggccaacgga
ttcatcttggatggctatccacgctcggtcgagcaggccaaggcgcttcacgagatgctc
gaacgccgggggaccgacatcgacgcggtgctggagtttcgtgtgtccgaggaggtgttg
ttggagcgactcaaggggcgtggccgcgccgacgacaccgacgacgtcatcctcaaccgg
atgaaggtctaccgcgacgagaccgcgccgctgctggagtactaccgcgaccaattgaag
accgtcgacgccgtcggcaccatggacgaggtgttcgcccgtgcgttgcgggctctggga
aagtag

DBGET integrated database retrieval system