KEGG   Mycobacterium tuberculosis H37Rv: Rv0753cHelp
Entry
Rv0753c           CDS       T00015                                 

Gene name
mmsA
Definition
(RefSeq) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  
malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Inositol phosphate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv0753c (mmsA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rv0753c (mmsA)
   00562 Inositol phosphate metabolism
    Rv0753c (mmsA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv0753c (mmsA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv0753c (mmsA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     Rv0753c (mmsA)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     Rv0753c (mmsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(844421..845953)
Genome map
AA seq 510 aa AA seqDB search
MTTQISHFIDGQRTAGQSTRSADVFDPNTGQIQAKVPMAGKSDIDAAVASAVEAQKGWAA
WNPQRRARVLMRFIELVNDTIDELAELLSREHGKTLADARGDVQRGIEVIEFCLGIPHLL
KGEYTEGAGPGIDVYSLRQPLGVVAGITPFNFPAMIPLWKAGPALACGNAFVLKPSERDP
SVPVRLAELFIEAGLPAGVFQVVHGDKEAVDAILHHPDIKAVGFVGSSDIAQYIYAGAAA
TGKRAQCFGGAKNHMIVMPDADLDQAVDALIGAGYGSAGERCMAISVAVPVGDQTAERLR
ARLIERINNLRVGHSLDPKADYGPLVTGAALARVRDYIGQGVAAGAELVVDGRDRASDDL
TFGLPEGDANLEGGFFIGPTLFDHVAAHMSIYTDEIFGPVLCMVRARDYEEALRLPSEHE
YGNGVAIFTRDGDAARDFVSRVQVGMVGVNVPIPVPVAYHTFGGWKRSGFGDLNQHGPAA
IQFYTKVKTVTSRWPSGIKDGAEFVIPTMS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacagatttcacatttcatcgacggacaacgcaccgccggccagtccacgcgc
tcggccgacgtcttcgaccccaacaccggccagatccaggcgaaggtaccgatggccggc
aagtcagacatcgacgcggccgtggcctccgcggtcgaggcccaaaagggctgggccgca
tggaatccccagcgccgtgcccgggtgttgatgcggtttatcgaactggtcaacgacacc
atcgacgagttggccgagctgttgtcgcgtgagcacggcaaaacgctggccgacgcccgc
ggcgacgtccagcgcggcatcgaggtaatcgagttctgcctgggcattccccacctgctc
aagggcgagtacaccgagggtgccggccccggcatcgacgtctattcgctgcggcagccc
ctgggtgtggtcgcggggatcaccccgttcaacttcccggcgatgattccgctgtggaag
gccggcccggccctagcgtgcggcaacgccttcgtgctcaagccaagtgagcgcgacccg
tcggttccggtgaggctggccgagctgttcatcgaggcgggcctgccggcgggcgtgttc
caggtggtgcacggcgacaaggaggccgtcgacgccatcctgcaccaccccgacatcaag
gccgtcggcttcgtcggcagctcggatatcgctcagtacatctacgctggtgccgccgcc
accggcaagcgggcgcagtgtttcggcggtgccaagaaccacatgatcgtgatgcccgac
gcggacctggatcaggccgtggacgcactgatcggcgccggatacggcagcgccggcgaa
cgctgcatggcgatcagcgtcgccgtgccggtgggcgatcagaccgcggagcggttgcgc
gccaggctgatcgagcggatcaataacttgcgggtgggacacagcctggaccccaaggcg
gactacggcccgctggtcaccggggcggcgctggcgcgggtgcgcgactacatcggccag
ggtgtggccgccggtgccgagctggtcgttgacggccgcgaccgcgccagcgacgacctg
acctttgggctgcctgaaggcgatgcgaacctggagggcggcttcttcatcgggccgacc
ctgttcgaccatgtcgctgcccacatgtcgatctacaccgacgaaatcttcgggccggtg
ttgtgcatggttcgcgcccgcgactacgaagaggcgttgcggctgccgtcggagcacgaa
tacggcaacggggtggcgatcttcacccgcgacggcgacgcggcccgcgacttcgtctcc
cgggtgcaggtgggcatggtcggcgtcaacgtgccgatcccggtgccggtggcctaccac
actttcggcggctggaagcgctccggcttcggcgacctcaaccagcacggcccggcggca
atccagttctacaccaaggtcaagaccgtcacgtcgcgatggccgtcaggcatcaaggac
ggtgccgaattcgtcatccccacaatgagttag

DBGET integrated database retrieval system