KEGG   Mycobacterium tuberculosis H37Rv: Rv0757Help
Entry
Rv0757            CDS       T00015                                 

Gene name
phoP
Definition
(RefSeq) two component system response transcriptional positive regulator PhoP
  KO
K02483  
two-component system, OmpR family, response regulator
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Two-component system [BR:mtu02022]
 OmpR family
  Unclassified
   Rv0757 (phoP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
851608..852351
Genome map
AA seq 247 aa AA seqDB search
MRKGVDLVTAGTPGENTTPEARVLVVDDEANIVELLSVSLKFQGFEVYTATNGAQALDRA
RETRPDAVILDVMMPGMDGFGVLRRLRADGIDAPALFLTARDSLQDKIAGLTLGGDDYVT
KPFSLEEVVARLRVILRRAGKGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFT
LLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVG
YVLREPR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaaggggttgatctcgtgacggcgggaaccccaggcgaaaacaccacaccggag
gctcgtgtcctcgtggtcgatgatgaggccaacatcgttgaactgctgtcggtgagcctc
aagttccagggctttgaagtctacaccgcgaccaacggggcacaggcgctggatcgggcc
cgggaaacccggccggacgcggtgatcctcgatgtgatgatgcccgggatggacggcttt
ggggtgctgcgccggctgcgcgccgacggcatcgatgccccggcgttgttcctgacggcc
cgtgactcgctacaggacaagatcgcgggtctgaccctgggtggtgacgactatgtgaca
aagcccttcagtttggaggaggtcgtggccaggctgcgggtcatcctgcgacgcgcgggc
aagggcaacaaggaaccacgtaatgttcgactgacgttcgccgatatcgagctcgacgag
gagacccacgaagtgtggaaggcgggccaaccggtgtcgctgtcgcccaccgaattcacc
ctgctgcgctatttcgtgatcaacgcgggcaccgtgctgagcaagcctaagattctcgac
cacgtttggcgctacgacttcggtggtgatgtcaacgtcgtcgagtcctacgtgtcgtat
ctgcgccgcaagatcgacactggggagaagcggctgctgcacacgctgcgcggggtgggc
tacgtactgcgggagcctcgatga

DBGET integrated database retrieval system