KEGG   Mycobacterium tuberculosis H37Rv: Rv0772Help
Entry
Rv0772            CDS       T00015                                 

Gene name
purD
Definition
(RefSeq) phosphoribosylamine--glycine ligase
  KO
K01945  
phosphoribosylamine--glycine ligase [EC:6.3.4.13]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rv0772 (purD)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     Rv0772 (purD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
864586..865854
Genome map
AA seq 422 aa AA seqDB search
MRVLVIGSGAREHALLLALGKDPQVSGLIVAPGNAGTARIAEQHDVDITSAEAVVALARE
VGADMVVIGPEVPLVLGVADAVRAAGIVCFGPGKDAARIEGSKAFAKDVMAAAGVRTANS
EIVDSPAHLDAALDRFGPPAGDPAWVVKDDRLAAGKGVVVTADRDVARAHGAALLEAGHP
VLLESYLDGPEVSLFCVVDRTVVVPLLPAQDFKRVGEDDTGLNTGGMGAYAPLPWLPDNI
YREVVSRIVEPVAAELVRRGSSFCGLLYVGLAITARGPAVVEFNCRFGDPETQAVLALLE
SPLGQLLHAAATGKLADFGELRWRDGVAVTVVLAAENYPGRPRVGDVVVGSEAEGVLHAG
TTRRDDGAIVSSGGRVLSVVGTGADLSAARAHAYEILSSIRLPGGHFRSDIGLRAAEGKI
SV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtcctggtaatcggttcgggtgcccgcgaacatgcgctattgctggcgctcggc
aaagacccgcaggtttcggggctaatcgttgctcccggcaatgcaggcaccgctcggatc
gccgagcagcacgacgtcgacatcacctccgccgaggcggtggtcgccctggctcgcgaa
gtcggcgctgacatggtggtgattggccccgaggtaccgttagtgctcggggtggccgac
gccgtgcgcgcggccggcatcgtgtgtttcgggcccggtaaggacgcggctcgcatcgaa
ggctccaaagcattcgccaaggacgtcatggcggcggccggtgtgcgcaccgcgaacagc
gaaatcgtagacagcccagcgcacttggacgcggccctggaccggttcgggccgcctgcc
ggtgacccggcctgggtggtcaaagacgaccggctagccgccggcaagggtgtggtggtg
acagcggaccgcgatgtcgcgcgcgcacacggagctgccctgctcgaggccgggcacccg
gtgttgctggagtcctacctggacggcccggaggtatcgctgttctgtgtcgtcgaccgc
accgtcgtggtgccgctgctgccggcacaggacttcaagcgagtcggtgaggacgacacc
ggacttaacaccggcggtatgggcgcctacgcgccgctgccgtggttgcccgacaacatc
tatcgggaggtggtcagccggatcgtcgaacccgttgcggccgaactagtccggcgtgga
agctcgttttgcggattgctgtatgttggtctcgcgattaccgcccgcgggccggcggtg
gtcgagttcaactgccgattcggcgatccggagacccaagccgtgctggccttgctggag
tctccgctcggccaactgcttcatgccgccgctaccgggaagctggccgatttcggcgag
ttgcggtggcgtgacggtgtggccgtaacagtggtactggcggccgaaaactatcccggg
cgcccccgggtcggcgacgtcgttgtcggctccgaagccgagggggtgctgcacgccgga
accacgcggcgcgacgatggcgcgatcgtttcgtccggtggccgggtgctgtcggtggtg
ggcaccggtgccgacttgtccgcagcacgcgcacacgcgtatgaaatcctcagttcaatt
cggttgccaggaggtcatttccgcagcgatatcggtttacgggcggccgaggggaagatc
agcgtctag

DBGET integrated database retrieval system