KEGG   Mycobacterium tuberculosis H37Rv: Rv0777Help
Entry
Rv0777            CDS       T00015                                 

Gene name
purB
Definition
(RefSeq) adenylosuccinate lyase PurB
  KO
K01756  
adenylosuccinate lyase [EC:4.3.2.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rv0777 (purB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv0777 (purB)
Enzymes [BR:mtu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     Rv0777 (purB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
870008..871426
Genome map
AA seq 472 aa AA seqDB search
MSIPNVLATRYASAEMVAIWSPEAKVVSERRLWLAVLRAQAELGVAVADSVLADYERVVD
DVDLASISARERVLRHDVKARIEEFNALAGHEHVHKGMTSRDLTENVEQLQIRRSLEVIF
AHGVAAVARLAERAVSYRDLIMAGRSHNVAAQATTLGKRFASAAQEMMIALRRLRELIDR
YPLRGIKGPMGTGQDMLDLLGGDRAALADLERRVADFLGFATVFNSVGQVYPRSLDHDVV
SALVQLGAGPSSLAHTIRLMAGHELATEGFAPGQVGSSAMPHKMNTRSCERVNGLQVVLR
GYASMVAELAGAQWNEGDVFCSVVRRVALPDSFFAVDGQIETFLTVLDEFGAYPAVIGRE
LDRYLPFLATTKVLMAAVRAGMGRESAHRLISEHAVATALAMREHGAEPDLLDRLAADPR
LTLGRDALEAALADKKAFAGAAGDQVDDVVAMVDALVSRYPDAAKYTPGAIL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgagcattcccaacgtgctggccacccgatacgccagcgccgagatggtcgcgatctgg
tcgccggaggccaaggtggtctcggagcggcggttatggctggccgtattgcgggcacag
gcagagctgggggtagcggttgccgattcggtgctcgccgactacgaacgtgtggtcgac
gatgtggacttggcctcgatctcagcccgggagcgggtgctgcgccacgatgtcaaggcc
cgcatcgaggaattcaacgcattggccggtcatgagcacgtgcacaaggggatgaccagc
cgcgacctgaccgagaacgtggagcaactgcagattcggcggtcgctggaagtgattttc
gcccatggggtggcggcggtggcgcggctggccgagcgggcggtgagctaccgtgacctg
atcatggccgggcgcagccacaacgtggccgctcaggccaccaccttgggcaagcggttc
gcctcggcggcccaagagatgatgatcgcgttgaggcggttgagggagttgatcgaccgc
taccccctgcgtggcatcaagggcccgatgggcaccggtcaggacatgctcgatctgctg
ggcggtgaccgtgcggcgctggccgatctcgagcggcgcgtcgccgacttcttgggcttt
gcaactgttttcaacagcgtggggcaggtgtatccgcgttcattggaccacgacgtggtt
tcggctctggtgcagctcggcgcggggccgtcatcactggcacacacgattcgattgatg
gccggccacgagctcgccaccgagggtttcgcgccgggtcaggtcggttcgtcggcgatg
ccgcacaagatgaacacccgcagctgcgaacgggtcaacgggctgcaggttgtgctacgc
ggctatgcatccatggtggccgagttagccggtgcacagtggaacgagggtgatgtgttt
tgctccgtggtgcgccgggttgcgttgccggacagcttctttgccgtcgacgggcagatc
gagacgtttttgacggtgctggacgagttcggcgcctacccggcggtgatcggccgcgag
ttggatcgttatctgccgttcctggccaccactaaggtgctaatggcggccgtgcgcgcg
gggatgggtcgcgagtccgcgcaccggttgatctccgagcacgcggtggcgacggcgctg
gccatgcgagaacacggcgcggagcccgacctgctggaccggttggccgccgatccgcgg
ctgacgctgggacgagacgctttggaggccgcgctggccgacaagaaggcatttgccggt
gccgcgggtgaccaggtcgatgatgtggtcgcgatggtggacgcgctggtgagccgttac
ccggacgcggctaaatacacgccgggtgcaattctttag

DBGET integrated database retrieval system