KEGG   Mycobacterium tuberculosis H37Rv: Rv0808Help
Entry
Rv0808            CDS       T00015                                 

Gene name
purF
Definition
(RefSeq) amidophosphoribosyltransferase
  KO
K00764  
amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rv0808 (purF)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv0808 (purF)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     Rv0808 (purF)
Peptidases [BR:mtu01002]
 Cysteine Peptidases
  Family C44
   Rv0808 (purF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
902111..903694
Genome map
AA seq 527 aa AA seqDB search
MAVDSDYVTDRAAGSRQTVTGQQPEQDLNSPREECGVFGVWAPGEDVAKLTYYGLYALQH
RGQEAAGIAVADGSQVLVFKDLGLVSQVFDEQTLAAMQGHVAIGHCRYSTTGDTTWENAQ
PVFRNTAAGTGVALGHNGNLVNAAALAARARDAGLIATRCPAPATTDSDILGALLAHGAA
DSTLEQAALDLLPTVRGAFCLTFMDENTLYACRDPYGVRPLSLGRLDRGWVVASETAALD
IVGASFVRDIEPGELLAIDADGVRSTRFANPTPKGCVFEYVYLARPDSTIAGRSVHAARV
EIGRRLARECPVEADLVIGVPESGTPAAVGYAQESGVPYGQGLMKNAYVGRTFIQPSQTI
RQLGIRLKLNPLKEVIRGKRLIVVDDSIVRGNTQRALVRMLREAGAVELHVRIASPPVKW
PCFYGIDFPSPAELIANAVENEDEMLEAVRHAIGADTLGYISLRGMVAASEQPTSRLCTA
CFDGKYPIELPRETALGKNVIEHMLANAARGAALGELAADDEVPVGR
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtagactcggattacgtcaccgaccgcgccgcagggagccgccaaaccgtgacc
ggccagcaacccgagcaagacctgaactcgccccgggaagagtgcggtgtcttcggggtc
tgggccccgggtgaagacgtcgccaaactcacctactacggcctgtacgcgttgcagcat
cgcggccaggaagccgccgggatcgccgtcgccgacggctcccaggtgctggtcttcaaa
gacctcggcctggtcagccaggtgttcgacgagcagacgttggcggccatgcagggccat
gtcgccatcgggcactgtcgttactccaccaccggggacacgacgtgggagaacgcccag
cccgtgttccgcaacaccgccgctggcaccggtgttgcgttgggccacaacggaaatctg
gtcaatgccgctgcccttgccgcccgcgcccgcgacgcggggttgatcgccacccgctgc
ccagccccggcgacgacggactccgacattctgggggcgctgctggcccacggtgctgcc
gattccaccctcgaacaggcggcgctggacctgctgcccacagtgcggggagcgttctgt
ctgacgttcatggacgaaaacacgctttatgcgtgccgcgacccgtacggggtgcgcccg
ctatcgctcgggcgtttggaccgtggctgggtggtggcctccgaaacggccgcactcgac
atcgtcggcgcctcgttcgtccgtgatatcgaaccgggcgaattgctggctatcgacgcc
gacggggtgcggtccacccgctttgccaaccccacgcccaagggctgcgtattcgaatac
gtctacctggcgcggccggacagtacgatcgccggccggtcggtacacgccgcgcgggtg
gagatcggtcgccgactggctcgggaatgcccggtcgaggccgacttggtgattggtgtg
ccggaatccggcacacccgccgcggtcggctacgcgcaggagtccggcgttccatatggg
cagggtctgatgaagaacgcctatgtcgggcgcaccttcatccagccgtcacagaccatc
cgtcagctcggcatccggctgaagctcaacccgctcaaagaggtgatccgcggcaagcgg
ctcatcgtcgtcgacgactcgatcgtgcggggcaacacccagcgtgcgctggtacgcatg
ctgcgcgaggccggtgcggtcgaattgcatgtgcgcatcgcctcgccaccggtgaagtgg
ccgtgcttctacggtatcgacttcccctcgccggccgagttgatcgccaacgccgtggaa
aacgaggacgagatgctggaggcggtacggcatgccatcggggccgacacgctgggatac
atctcgctgcggggcatggtcgcggcgtccgagcagcccacgtcgcggctgtgcaccgct
tgcttcgacggcaagtatccaatagagctgccccgcgagaccgcgctaggcaaaaatgtc
atcgagcacatgctcgccaatgcggcccgcggagccgcgctgggcgaactcgccgccgac
gacgaagtccccgttgggcgctga

DBGET integrated database retrieval system