KEGG   Mycobacterium tuberculosis H37Rv: Rv0812Help
Entry
Rv0812            CDS       T00015                                 

Gene name
pabC
Definition
(RefSeq) 4-amino-4-deoxychorismate lyase
  KO
K02619  
4-amino-4-deoxychorismate lyase [EC:4.1.3.38]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rv0812 (pabC)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.38  aminodeoxychorismate lyase
     Rv0812 (pabC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
906423..907292
Genome map
AA seq 289 aa AA seqDB search
MVVTLDGEILQPGMPLLHADDLAAVRGDGVFETLLVRDGRACLVEAHLQRLTQSARLMDL
PEPDLPRWRRAVEVATQRWVASTADEGALRLIYSRGREGGSAPTAYVMVSPVPARVIGAR
RDGVSAITLDRGLPADGGDAMPWLIASAKTLSYAVNMAVLRHAARQGAGDVIFVSTDGYV
LEGPRSTVVIATDGDQGGGNPCLLTPPPWYPILRGTTQQALFEVARAKGYDCDYRALRVA
DLFDSQGIWLVSSMTLAARVHTLDGRRLPRTPIAEVFAELVDAAIVSDR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtcacgcttgacggtgagatcctgcagccgggtatgccgctgctgcacgccgat
gatcttgccgctgtgcggggggatggcgttttcgagacactgctggtgcgcgacggccga
gcctgtctggttgaagcgcacctgcagcggctgacccaatcagccaggttgatggacctt
cccgaaccggatctccccaggtggcgccgcgcggtcgaggtggcaacgcagcggtgggtg
gctagcaccgctgacgagggcgcgctgcgcttgatctacagtcgcggtcgggagggcggc
tcggcgccgacggcctatgtcatggtcagtccggtcccggcgcgagttatcggggcccgc
cgcgatggtgtgtcggcgatcacgctggaccgcggtttgccggctgacggtggcgacgcc
atgccgtggctgatagccagcgccaaaacactgtcctatgcggtgaacatggccgtcctg
cgtcatgccgcccggcagggcgccggcgacgtcatcttcgtcagcacggacggctacgtc
ctggaaggccctcgctcgacggtggtgatcgccaccgacggtgaccaagggggcgggaac
ccctgcttgctgacgccgcctccgtggtatccaatcctgcggggaaccacgcaacaagcg
ctcttcgaagtggcccgcgcgaaaggctacgactgcgactaccgtgccctacgcgtcgcc
gatctcttcgattcccaaggtatttggttggtatcgagcatgactctggccgcccgcgta
cacaccctggacgggcggcgattaccccgcaccccgatcgctgaggtgtttgccgaattg
gtggacgccgctattgtcagcgaccggtga

DBGET integrated database retrieval system