KEGG   Mycobacterium tuberculosis H37Rv: Rv0819Help
Entry
Rv0819            CDS       T00015                                 

Gene name
mshD
Definition
(RefSeq) mycothiol acetyltransferase
  KO
K15520  
mycothiol synthase [EC:2.3.1.189]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.189  mycothiol synthase
     Rv0819 (mshD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
911736..912683
Genome map
AA seq 315 aa AA seqDB search
MTALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQVLRELGQQRTEHLLVAGSRPGGP
IIGYLNLSPPRGAGGAMAELVVHPQSRRRGIGTAMARAALAKTAGRNQFWAHGTLDPARA
TASALGLVGVRELIQMRRPLRDIPEPTIPDGVVIRTYAGTSDDAELLRVNNAAFAGHPEQ
GGWTAVQLAERRGEAWFDPDGLILAFGDSPRERPGRLLGFHWTKVHPDHPGLGEVYVLGV
DPAAQRRGLGQMLTSIGIVSLARRLGGRKTLDPAVEPAVLLYVESDNVAAVRTYQSLGFT
TYSVDTAYALAGTDN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcgcttgactggcgctccgctctgaccgccgacgagcagcgcagcgtgcgtgca
ctggtcacggcgacaacagcagtcgatggggtagcacccgtgggtgaacaggtgctgcgg
gaactgggccagcaacgcaccgagcatctgctggtggccggttcgcgaccgggcggcccg
atcatcggctacctcaacctcagcccaccccggggcgcgggtggtgcgatggcggagttg
gtggtgcatccgcagtctcgacggcgcggtatcggcaccgccatggcccgcgcggcattg
gccaagaccgccggccgcaaccagttctgggcgcacggcacgctggatcccgctcgggcg
accgcgtccgcgctgggtctggtcggcgtccgcgaactgatccagatgcgacgcccgctg
cgtgatatccccgaaccgacgatccccgacggggtggtgatccgcacctacgcgggcacg
tccgacgacgctgagctactccgggtcaacaacgccgcgttcgccggacacccggaacag
ggtgggtggaccgcggtccagcttgccgagcggcgtggcgaggcgtggttcgatccagac
ggcctgatcttggccttcggtgattcgccacgtgaacggcctggccggttgctgggtttc
cattggaccaaagtgcatcccgatcacccgggattgggcgaggtgtacgtgctgggcgtc
gatccggcggcgcagcgccgcggtctcggccagatgttgacgtcgatcggtatcgtctcg
ctggcccgtcggctgggcggtcggaagaccctcgaccctgcggtcgaacccgccgtgctg
ctctacgtggagtcggacaatgtggcggccgtgcgaacctaccagagcctgggcttcacc
acctacagcgtcgataccgcctacgcgctggctggcacggataactga

DBGET integrated database retrieval system