KEGG   Mycobacterium tuberculosis H37Rv: Rv0884cHelp
Entry
Rv0884c           CDS       T00015                                 

Gene name
serC
Definition
(RefSeq) phosphoserine aminotransferase
  KO
K00831  
phosphoserine aminotransferase [EC:2.6.1.52]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv0884c (serC)
   01230 Biosynthesis of amino acids
    Rv0884c (serC)
  Energy metabolism
   00680 Methane metabolism
    Rv0884c (serC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv0884c (serC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rv0884c (serC)
Enzymes [BR:mtu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     Rv0884c (serC)
Amino acid related enzymes [BR:mtu01007]
 Aminotransferase (transaminase)
  Class V
   Rv0884c (serC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(981424..982554)
Genome map
AA seq 376 aa AA seqDB search
MADQLTPHLEIPTAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGR
VRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGLIDKRSLHLTYGEFSAKFASAVSKNP
FVGEPIIITSDPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRPEGSDDALVVIDATSG
AGGLPVDIAETDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIA
VENSLKNQTYNTPAIATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTP
FVTDPGLRSQVVGTIDFVDDVDAGTVAKILRANGIVDTEPYRKLGRNQLRVAMFPAVEPD
DVSALTECVDWVVERL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccagctcaccccccacctggaaattcccaccgccatcaaaccccgcgacggc
cgctttgggtcgggcccgtcgaaggtccggcttgagcaactgcaaacgctgaccaccacc
gcagcggcattgttcggcacgtcgcaccgacaggcgccggtcaagaatctggtgggcagg
gttcggtcaggcctggccgagctgttctcgttgccggacggctatgaggtgatactgggc
aatggtggtgccacggcgttctgggatgcggccgccttcgggctgattgacaaacgctca
ctgcacttgacttacggcgagttcagcgcgaagttcgcttccgccgtttccaagaacccg
ttcgtcggcgagccgatcatcatcacgtcggatcccggcagtgctccggagccgcaaacc
gacccgtcagtcgatgtgatcgcctgggcccacaacgagacctcgaccggggtcgcggtt
gcggtgcgccgtccggagggctccgatgacgccttggtcgtcatcgacgccacctccggt
gctggcggcctaccggtcgacatcgccgagaccgacgcctactacttcgcaccgcagaag
aacttcgccagcgacggcggcctgtggctggccatcatgagcccggccgccctgagccgg
atcgaggccatcgccgcgaccggtcgctgggttcctgatttcctgtccctgccgatcgcg
gtcgagaacagcttgaagaaccagacatacaacacaccggccatcgccacgctggcgctg
ctggccgaacagatcgactggctggtgggtaacggtggcttggactgggcggtcaaacgc
accgcggactcgtcgcagcggttgtactcgtgggcgcaagagcggccctacaccacgcca
tttgtcaccgaccccgggttgcggtcgcaggtggtgggcacgatcgacttcgtcgacgac
gtcgacgccgggaccgtcgcgaagatcctgcgggctaacggcatcgtcgacaccgagccg
tatcgcaaactgggccgaaaccagctgcgggtcgcgatgttccccgcggtcgagccggac
gacgtcagcgccctcaccgagtgcgtcgactgggtggtcgagcggctttag

DBGET integrated database retrieval system