KEGG   Mycobacterium tuberculosis H37Rv: Rv0896Help
Entry
Rv0896            CDS       T00015                                 

Gene name
gltA2
Definition
(RefSeq) citrate synthase 1
  KO
K01647  
citrate synthase [EC:2.3.3.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtu00001]
   00020 Citrate cycle (TCA cycle)
    Rv0896 (gltA2)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv0896 (gltA2)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Rv0896 (gltA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
999472..1000767
Genome map
AA seq 431 aa AA seqDB search
MADTDDTATLRYPGGEIDLQIVHATEGADGIALGPLLAKTGHTTFDVGFANTAAAKSSIT
YIDGDAGILRYRGYPIDQLAEKSTFIEVCYLLIYGELPDTDQLAQFTGRIQRHTMLHEDL
KRFFDGFPRNAHPMPVLSSVVNALSAYYQDALDPMDNGQVELSTIRLLAKLPTIAAYAYK
KSVGQPFLYPDNSLTLVENFLRLTFGFPAEPYQADPEVVRALDMLFILHADHEQNCSTST
VRLVGSSRANLFTSISGGINALWGPLHGGANQAVLEMLEGIRDSGDDVSEFVRKVKNREA
GVKLMGFGHRVYKNYDPRARIVKEQADKILAKLGGDDSLLGIAKELEEAALTDDYFIERK
LYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWREMHDEGDSKIGRPRQIYTGY
TERDYVTIDAR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacaccgacgacaccgcaaccctccgttacccgggaggcgagatcgacctgcag
atcgtgcacgccaccgaaggcgccgacggcattgcgctcgggccgctgctggcaaaaacc
gggcacaccacgttcgacgtcggcttcgccaacacggccgccgctaaaagctccatcacc
tacatcgacggagatgccggcattctgcgttatcgcggctacccgatcgaccaactggcg
gagaagtcaaccttcatcgaggtctgctacctgttgatttacggcgagctgcccgatacc
gaccagcttgcccagttcaccggccggatccagcgccacaccatgctgcacgaggatctc
aagcggttcttcgacggctttccgcgcaatgcccacccgatgccggtgttgtccagcgtg
gtcaatgcgctgtcggcgtactaccaggatgctctggaccccatggacaacggtcaagtc
gagctgtcgaccattcggctgctggccaagctgcccaccatcgccgcgtacgcctacaag
aaatcggtcggccagcccttcctctacccagataactcactgacgctggtggagaacttc
ctacggttgacgttcggatttcccgccgagccctaccaggccgaccccgaggtggtgcgg
gcgctggacatgttgttcatcttgcacgccgaccacgagcagaactgctcgacgtcgacg
gttcggctggttggctcgtcgcgagccaacctgttcacctcgatctcgggtggcatcaac
gcactatggggtccgcttcatggcggcgccaatcaggctgtcctggagatgctcgagggc
attcgcgacagcggcgacgacgtcagcgagtttgtacgcaaggtcaagaaccgcgaggcc
ggggtcaaattgatgggtttcggtcatcgtgtctacaagaactacgatccgcgggcccgc
atcgtcaaggaacaggccgacaagatcctggccaagctcggcggcgatgactccttgctg
ggcatcgccaaggagctcgaagaggcggcgctgaccgacgactacttcatcgaacgcaag
ctttaccccaacgtcgacttctacaccggcctgatctaccgggccctcggcttcccgacc
aggatgttcaccgtgttgtttgccctgggcaggcttcccggctggatcgcgcactggcgt
gagatgcacgacgagggcgacagcaagatcggccggccccgccagatctacaccggctac
acggagcgcgactacgtcaccatagacgcgcggtag

DBGET integrated database retrieval system