KEGG   Mycobacterium tuberculosis H37Rv: Rv0904cHelp
Entry
Rv0904c           CDS       T00015                                 

Gene name
accD3
Definition
(RefSeq) acetyl-CoAcarboxylase carboxyl transferase subunit beta
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00061  Fatty acid biosynthesis
mtu00620  Pyruvate metabolism
mtu00640  Propanoate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01212  Fatty acid metabolism
Module
mtu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rv0904c (accD3)
   00640 Propanoate metabolism
    Rv0904c (accD3)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Rv0904c (accD3)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Rv0904c (accD3)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Rv0904c (accD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans ECH_1 ACCA MdcE
Motif
Other DBs
NCBI-GeneID: 885279
NCBI-ProteinID: NP_215419
TubercuList: Rv0904c
UniProt: P9WQH9 I6WZQ9
Position
complement(1006693..1008180)
Genome map
AA seq 495 aa AA seqDB search
MSRITTDQLRHAVLDRGSFVSWDSEPLAVPVADSYARELAAARAATGADESVQTGEGRVF
GRRVAVVACEFDFLGGSIGVAAAERITAAVERATAERLPLLASPSSGGTRMQEGTVAFLQ
MVKIAAAIQLHNQARLPYLVYLRHPTTGGVFASWGSLGHLTVAEPGALIGFLGPRVYELL
YGDPFPSGVQTAENLRRHGIIDGVVALDRLRPMLDRALTVLIDAPEPLPAPQTPAPVPDV
PTWDSVVASRRPDRPGVRQLLRHGATDRVLLSGTDQGEAATTLLALARFGGQPTVVLGQQ
RAVGGGGSTVGPAALREARRGMALAAELCLPLVLVIDAAGPALSAAAEQGGLAGQIAHCL
AELVTLDTPTVSILLGQGSGGPALAMLPADRVLAALHGWLAPLPPEGASAIVFRDTAHAA
ELAAAQGIRSADLLKSGIVDTIVPEYPDAADEPIEFALRLSNAIAAEVHALRKIPAPERL
ATRLQRYRRIGLPRD
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgtatcacgaccgaccaactgcggcacgcggtgctagaccggggatctttcgtc
agctgggatagcgagccgctggcggtgccggtagccgactcctatgcgcgggagctggcc
gccgctcgggcggccaccggcgcggacgaatcggtgcagaccggtgagggacgcgtattc
gggcggcgggtggccgtggtggcctgtgagttcgacttcctgggcggctcgattggggtg
gcagcggccgaacggatcaccgccgccgtcgagcgggcgaccgccgagcggctgccgcta
ctggcgtcaccaagctcgggaggcacccgcatgcaagaaggcacggtcgcgtttctgcag
atggtgaagatcgctgcggccatccagctgcacaaccaggcgcgcctgccctacctggtc
tatttgcgccatccgaccacgggtggagttttcgcgtcgtggggctcgctggggcatctc
accgtcgccgagccgggcgccctgatcggctttctgggaccacgggtctatgagttgctc
tatggcgaccccttcccatccggcgtccaaaccgccgagaatctacggcggcatgggatc
atcgacggcgtcgttgcactggaccggctacgaccgatgctggatcgtgcgttgacggtg
ctcatcgacgctcccgaaccgcttccggcaccgcagacgcccgcgcccgtacccgatgtg
cccacgtgggactcggtggtggcatcgcgccggccggaccggccgggcgtcaggcagcta
ctgcgacacggcgccaccgaccgggtgttgttgtcaggaaccgatcaaggcgaagcggcg
accacgctgctggcgctggcccgctttggcggccaacccacggtggtcctcggccagcaa
agggcagtaggcggcgggggaagcactgtcgggcccgctgcgttacgcgaagcccgacgc
gggatggcgctcgccgccgagctgtgcctgccgctggtgctggtcattgacgcggccgga
cccgcgttgtcggccgcagccgaacagggcgggctggccggccagatcgcgcattgcctg
gccgagctcgtcacgctggataccccgaccgtgtcgatcctgctgggccagggcagcggc
gggccggcgctggcgatgttgcccgccgaccgggtgctggccgcactccacggctggctg
gcgcccttgcctcccgaaggagccagcgcgatcgtgttccgagacactgctcatgccgcc
gaactcgctgccgcccaaggcatccggtcggccgacctactgaagtcggggattgtcgac
accatcgtgccggagtaccccgacgccgcagacgagccgatcgagttcgccctacgactg
tcgaacgccatcgccgccgaagtgcacgcgttacggaagataccggccccggaacgcctc
gcgactcggttgcaacgctaccgccggatcgggttgccccgcgactaa

DBGET integrated database retrieval system