KEGG   Mycobacterium tuberculosis H37Rv: Rv0904cHelp
Entry
Rv0904c           CDS       T00015                                 

Gene name
accD3
Definition
(RefSeq) acetyl-CoAcarboxylase carboxyl transferase subunit beta
  KO
K01962  
acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2]
K01963  
acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rv0904c (accD3)
   00640 Propanoate metabolism
    Rv0904c (accD3)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Rv0904c (accD3)
Enzymes [BR:mtu01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Rv0904c (accD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(1006693..1008180)
Genome map
AA seq 495 aa AA seqDB search
MSRITTDQLRHAVLDRGSFVSWDSEPLAVPVADSYARELAAARAATGADESVQTGEGRVF
GRRVAVVACEFDFLGGSIGVAAAERITAAVERATAERLPLLASPSSGGTRMQEGTVAFLQ
MVKIAAAIQLHNQARLPYLVYLRHPTTGGVFASWGSLGHLTVAEPGALIGFLGPRVYELL
YGDPFPSGVQTAENLRRHGIIDGVVALDRLRPMLDRALTVLIDAPEPLPAPQTPAPVPDV
PTWDSVVASRRPDRPGVRQLLRHGATDRVLLSGTDQGEAATTLLALARFGGQPTVVLGQQ
RAVGGGGSTVGPAALREARRGMALAAELCLPLVLVIDAAGPALSAAAEQGGLAGQIAHCL
AELVTLDTPTVSILLGQGSGGPALAMLPADRVLAALHGWLAPLPPEGASAIVFRDTAHAA
ELAAAQGIRSADLLKSGIVDTIVPEYPDAADEPIEFALRLSNAIAAEVHALRKIPAPERL
ATRLQRYRRIGLPRD
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgtatcacgaccgaccaactgcggcacgcggtgctagaccggggatctttcgtc
agctgggatagcgagccgctggcggtgccggtagccgactcctatgcgcgggagctggcc
gccgctcgggcggccaccggcgcggacgaatcggtgcagaccggtgagggacgcgtattc
gggcggcgggtggccgtggtggcctgtgagttcgacttcctgggcggctcgattggggtg
gcagcggccgaacggatcaccgccgccgtcgagcgggcgaccgccgagcggctgccgcta
ctggcgtcaccaagctcgggaggcacccgcatgcaagaaggcacggtcgcgtttctgcag
atggtgaagatcgctgcggccatccagctgcacaaccaggcgcgcctgccctacctggtc
tatttgcgccatccgaccacgggtggagttttcgcgtcgtggggctcgctggggcatctc
accgtcgccgagccgggcgccctgatcggctttctgggaccacgggtctatgagttgctc
tatggcgaccccttcccatccggcgtccaaaccgccgagaatctacggcggcatgggatc
atcgacggcgtcgttgcactggaccggctacgaccgatgctggatcgtgcgttgacggtg
ctcatcgacgctcccgaaccgcttccggcaccgcagacgcccgcgcccgtacccgatgtg
cccacgtgggactcggtggtggcatcgcgccggccggaccggccgggcgtcaggcagcta
ctgcgacacggcgccaccgaccgggtgttgttgtcaggaaccgatcaaggcgaagcggcg
accacgctgctggcgctggcccgctttggcggccaacccacggtggtcctcggccagcaa
agggcagtaggcggcgggggaagcactgtcgggcccgctgcgttacgcgaagcccgacgc
gggatggcgctcgccgccgagctgtgcctgccgctggtgctggtcattgacgcggccgga
cccgcgttgtcggccgcagccgaacagggcgggctggccggccagatcgcgcattgcctg
gccgagctcgtcacgctggataccccgaccgtgtcgatcctgctgggccagggcagcggc
gggccggcgctggcgatgttgcccgccgaccgggtgctggccgcactccacggctggctg
gcgcccttgcctcccgaaggagccagcgcgatcgtgttccgagacactgctcatgccgcc
gaactcgctgccgcccaaggcatccggtcggccgacctactgaagtcggggattgtcgac
accatcgtgccggagtaccccgacgccgcagacgagccgatcgagttcgccctacgactg
tcgaacgccatcgccgccgaagtgcacgcgttacggaagataccggccccggaacgcctc
gcgactcggttgcaacgctaccgccggatcgggttgccccgcgactaa

DBGET integrated database retrieval system