KEGG   Mycobacterium tuberculosis H37Rv: Rv0946cHelp
Entry
Rv0946c           CDS       T00015                                 

Gene name
pgi
Definition
(RefSeq) glucose-6-phosphate isomerase
  KO
K01810  
glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv0946c (pgi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv0946c (pgi)
   00030 Pentose phosphate pathway
    Rv0946c (pgi)
   00500 Starch and sucrose metabolism
    Rv0946c (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv0946c (pgi)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Rv0946c (pgi)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Rv0946c (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   Rv0946c (pgi)
  Exosomal proteins of colorectal cancer cells
   Rv0946c (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1055024..1056685)
Genome map
AA seq 553 aa AA seqDB search
MTSAPIPDITATPAWDALRRHHDQIGNTHLRQFFADDPGRGRELTVSVGDLYIDYSKHRV
TRETLALLIDLARTAHLEERRDQMFAGVHINTSEDRAVLHTALRLPRDAELVVDGQDVVT
DVHAVLDAMGAFTDRLRSGEWTGATGKRISTVVNIGIGGSDLGPVMVYQALRHYADAGIS
ARFVSNVDPADLIATLADLDPATTLFIVASKTFSTLETLTNATAARRWLTDALGDAAVSR
HFVAVSTNKRLVDDFGINTDNMFGFWDWVGGRYSVDSAIGLSLMTVIGRDAFADFLAGFH
IIDRHFATAPLESNAPVLLGLIGLWYSNFFGAQSRTVLPYSNDLSRFPAYLQQLTMESNG
KSTRADGSPVSADTGEIFWGEPGTNGQHAFYQLLHQGTRLVPADFIGFAQPLDDLPTAEG
TGSMHDLLMSNFFAQTQVLAFGKTAEEIAADGTPAHVVAHKVMPGNRPSTSILASRLTPS
VLGQLIALYEHQVFTEGVVWGIDSFDQWGVELGKTQAKALLPVITGAGSPPPQSDSSTDG
LVRRYRTERGRAG
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgcgccaatccccgacatcaccgctaccccggcatgggacgccctgcgcaga
catcacgatcagatcggaaacacccatcttcgccagttcttcgccgacgatccgggtcgc
ggccgggagctcaccgtcagcgtcggcgatctctacatcgactacagcaaacaccgcgtc
acccgcgagacgctggcgctgctgatcgatctggcccggacggcccacctcgaagagcgt
cgcgaccagatgttcgccggtgtgcatatcaacacctctgaggatcgagcggtgttgcac
accgcgctgcggctgccccgagacgccgaactcgtcgtcgacggccaagacgtcgtcacc
gacgtacatgccgtgctcgacgcgatgggcgccttcaccgaccgcctgcgcagcggcgag
tggaccggagcaactggaaagcggatcagcaccgtcgtcaacatcggcatcggtggttcg
gatttgggtccggtgatggtgtaccaagcgttgcgccactatgccgacgcgggcatttcc
gcgcgcttcgtgtccaacgtcgatcccgccgacctgatcgccacgctcgccgatctagac
cccgccacaacgcttttcatcgtcgcgtcgaagacgttctcgacgctggagacattgacc
aatgcgaccgcggcgcgtcgctggctgaccgatgcgctgggcgacgccgcggtgtcgcgg
cattttgtcgcggtgtccaccaacaagcgcctggtcgacgacttcggcatcaacaccgac
aacatgttcggtttttgggattgggtcggcgggcgttattcggtggattcggcgatcggg
ctgtcgttgatgacggtgatcggccgcgacgccttcgccgatttcttggccggattccac
atcatcgaccgccatttcgcgaccgctccgctggaatccaacgcgccggtgctgcttggc
ctgatcggactgtggtactccaatttcttcggtgcgcaatcacgcaccgtgctgccgtat
tccaatgacttgtcgcgttttccggcctaccttcagcagttgaccatggaatccaacggc
aagtccacgcgcgccgacggcagcccggtcagcgccgacaccggtgaaatcttttggggt
gaaccgggaaccaacggccagcacgccttctaccagttgctgcaccagggcacccggctg
gtgccagccgatttcatcggctttgctcaacccctcgacgacctgccgaccgccgagggc
accggcagcatgcatgatctgctgatgagcaacttcttcgcccaaacccaggtgctggcg
ttcggcaagaccgccgaggagatcgccgccgacggcacccccgcccacgtggtagcgcat
aaggtgatgcccggcaaccggccgtccacctcaattctggccagtcggctcacgccgtcg
gtgctggggcagttgatcgcgctctacgagcatcaggtgttcaccgagggtgtggtgtgg
ggtatcgactcgttcgaccagtggggggtggagctgggcaagacgcaggccaaggcgctg
cttccggtaatcaccggcgccggttcaccgccaccgcagtcggacagctcgaccgacggg
ctggtgcgccgctaccgcaccgaacgtggccgcgcgggctag

DBGET integrated database retrieval system