KEGG   Mycobacterium tuberculosis H37Rv: Rv0952Help
Entry
Rv0952            CDS       T00015                                 

Gene name
sucD
Definition
(RefSeq) succinyl-CoA ligase subunit alpha
  KO
K01902  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv0952 (sucD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv0952 (sucD)
   00640 Propanoate metabolism
    Rv0952 (sucD)
   00660 C5-Branched dibasic acid metabolism
    Rv0952 (sucD)
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rv0952 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1063140..1064051
Genome map
AA seq 303 aa AA seqDB search
MTHMSIFLSRDNKVIVQGITGSEATVHTARMLRAGTQIVGGVNARKAGTTVTHEDKGGRL
IKLPVFGSVAEAMEKTGADVSIIFVPPTFAKDAIIEAIDAEIPLLVVITEGIPVQDTAYA
WAYNLEAGHKTRIIGPNCPGIISPGQSLAGITPANITGPGPIGLVSKSGTLTYQMMFELR
DLGFSTAIGIGGDPVIGTTHIDAIEAFERDPDTKLIVMIGEIGGDAEERAADFIKTNVSK
PVVGYVAGFTAPEGKTMGHAGAIVSGSSGTAAAKQEALEAAGVKVGKTPSATAALAREIL
LSL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactcacatgtccatatttctgagcagggacaacaaggtcattgtgcagggcatcacc
ggcagtgaggccaccgtccataccgcgcgaatgctgcgggcgggcacgcaaatcgtcggc
ggtgtgaacgcacgcaaagcgggcaccaccgtcacgcatgaggataagggcggccggctg
atcaagctgccggtgttcggcagtgtcgcggaggcgatggaaaagaccggcgccgatgtg
tcgatcatcttcgtgccgccgacgttcgccaaggacgccatcatcgaggccatcgacgcc
gaaattccgctgttggttgtgatcaccgagggaattccggtgcaggacaccgcctatgcc
tgggcctacaacctcgaggctggccacaagacccgcatcattggccccaactgtcctggc
attatcagtcccggtcagtcgctggccggtatcacgccggccaacatcaccggacccggt
ccaattggtctggtgtccaagtcggggacgttgacctaccagatgatgttcgaactgcgc
gaccttggattctccacggcgatcggcatcggtggtgatccggtgattggcactacccac
atcgacgccatcgaggccttcgagagggatccggacaccaagctcatcgtgatgatcggc
gagatcggtggtgacgccgaggagcgggccgcagacttcatcaagaccaacgtgtccaag
ccggtcgtcggctatgtcgccggatttaccgcacccgaaggcaagacgatgggccacgcc
ggcgccatcgtctccggctcgtctggcacagcggcggccaagcaagaggccctggaggcc
gccggtgtgaaggtcggcaagaccccatcggcgaccgcggcgctggcccgggagatcttg
ctcagtctctag

DBGET integrated database retrieval system