KEGG   Mycobacterium tuberculosis H37Rv: Rv0974cHelp
Entry
Rv0974c           CDS       T00015                                 

Gene name
accD2
Definition
(RefSeq) acetyl-/propionyl-CoA carboxylase subunit beta
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(1085756..1087345)
Genome map
AA seq 529 aa AA seqDB search
MLQSTLDPNASAYDEAAATMSGKLDEINAELAKALAGGGPKYVDRHHARGNLTPRERIEL
LVDPDSPFLELSPLAAYGSNFQIGASLVTGIGAVCGVECMIVANDPTVKGGTSNPWTLRK
ILRANQIAFENRLPVISLVESGGADLPTQKEIFIPGGQMFRDLTRLSAAGIPTIALVFGN
STAGGAYVPGMSDHVVMIKERSKVFLAGPPLVKMATGEESDDESLGGAEMHARISGLADY
FALDELDAIRIGRRIVARLNWIKQGPAPAPVTEPLFDAEELIGIVPPDLRIPFDPREVIA
RIVDGSEFDEFKPLYGSSLVTGWARLHGYPLGILANARGVLFSEESQKATQFIQLANRAD
TPLLFLHNTTGYMVGKDYEEGGMIKHGSMMINAVSNSTVPHISLLIGASYGAGHYGMCGR
AYDPRFLFAWPSAKSAVMGGAQLSGVLSIVARAAAEARGQQVDEAADAAMRAAVEGQIEA
ESLPLVLSGMLYDDGVIDPRDTRTVLGMCLSAIANGPIKGTSNFGVFRM
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcaatccacactggacccgaacgcttccgcctacgacgaggcggccgcgacgatg
agcggcaagctcgacgagatcaacgccgaactggccaaggcgctcgccggcggtggcccc
aaatacgtcgaccggcaccacgcccgcggcaacctgacaccacgggaacgcatcgagctg
ctcgtcgacccggactccccgttcctggagctgagcccgctggccgcctacggcagcaac
ttccagatcggcgccagcctggtcaccggcatcggcgcggtctgcggcgtggaatgcatg
atcgtcgccaacgacccgacggtcaagggcggcaccagcaatccgtggacgcttcgaaag
atactgcgggccaaccagatcgccttcgaaaaccggcttcccgtcatttcgctggtggaa
tccggcggggccgatctgcccacccagaaagagattttcatccccggcggacagatgttc
cgcgacctgacccggctgtcggcggccgggatcccgaccattgcgctggttttcggcaac
tccaccgcgggcggtgcctacgtccccggcatgtccgatcacgtggtgatgatcaaggaa
cgctccaaggtgtttttggccggcccgccgctagtgaagatggccaccggcgaagagtcc
gacgacgagtcgctgggcggcgccgaaatgcacgcccgcatatcgggtttggccgactat
tttgcgctcgacgagctcgacgcgatccgcatcggacgccgcatcgtggcgcgactgaac
tggatcaaacagggacccgcacccgctccggtgaccgagccgctgttcgacgccgaggag
ctaatcggcatcgtgcccccggatctgcgcatcccattcgacccgcgcgaggtgatcgcc
cgcatcgtcgatggctccgagttcgacgaattcaagccgctgtacgggtcgtctctggtg
accggctgggctcggttgcacggctatccgctgggcatcctggccaacgcccgcggcgtg
ctgttcagcgaggaatcacagaaggccacccagttcatccagctggccaaccgggccgac
acgccgctgttgttcttacacaacaccaccggctacatggtgggcaaggactacgaggaa
ggcgggatgatcaagcatggctcgatgatgatcaacgccgtgtccaactcgaccgtcccg
cacatctcgctgctgatcggcgcgtcctacggcgccgggcactacggcatgtgcgggcgc
gcctacgacccgcgcttcctattcgcctggcccagcgccaagtccgcggtgatgggcggc
gcccagctgtcgggcgtgctgtccatcgtggcccgggcggcagccgaagcccgcgggcag
caagtcgacgaagccgccgacgcggcgatgcgggccgccgtcgagggccagatcgaagcc
gagtcgctaccgttggtgctgtccgggatgctttacgacgacggggtgatcgacccgcgc
gacacccgcaccgtgctgggaatgtgtttgtccgccatcgccaatggcccgatcaagggg
acgtcgaacttcggcgtcttccggatgtga

DBGET integrated database retrieval system