KEGG   Mycobacterium tuberculosis H37Rv: Rv0994Help
Entry
Rv0994            CDS       T00015                                 

Gene name
moeA1
Definition
(RefSeq) molybdopterin molybdenumtransferase 1
  KO
K03750  
molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rv0994 (moeA1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     Rv0994 (moeA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1110269..1111549
Genome map
AA seq 426 aa AA seqDB search
MRSVEEQQARISAAAVAPRPIRVAIAEAQGLMCAEEVVTERPMPGFDQAAIDGYAVRSVD
VAGVGDTGGVQVFADHGDLDGRDVLTLPVMGTIEAGARTLSRLQPRQAVRVQTGAPLPTL
ADAVLPLRWTDGGMSRVRVLRGAPSGAYVRRAGDDVQPGDVAVRAGTIIGAAQVGLLAAV
GRERVLVHPRPRLSVMAVGGELVDISRTPGNGQVYDVNSYALAAAGRDACAEVNRVGIVS
NDPTELGEIVEGQLNRAEVVVIAGGVGGAAAEAVRSVLSELGEMEVVRVAMHPGSVQGFG
QLGRDGVPTFLLPANPVSALVVFEVMVRPLIRLSLGKRHPMRRIVSARTLSPITSVAGRK
GYLRGQLMRDQDSGEYLVQALGGAPGASSHLLATLAEANCLVVVPTGAEQIRTGEIVDVA
FLAQHG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttctgtggaggagcagcaggctcggatatcggccgctgcggtagccccgaggccg
atacgcgttgcgatcgccgaggcgcagggattgatgtgcgccgaagaagtggtcaccgaa
cgtccaatgcccggttttgatcaggccgccatcgacggctacgcggtgcgcagtgtcgat
gtggccggtgtcggtgataccggtggtgtccaagtctttgccgaccacggcgatcttgac
ggtcgcgacgtgctgaccctaccggtgatgggaaccatcgaagccggagcgcgcaccctg
agcaggttgcagcctcgccaagcggtccgggtgcagaccggcgcgccgcttcccaccctg
gccgatgcggtcctgccgttgcggtggaccgatggcggaatgtctcgggtgcgggtgctg
cgcggggcgccgtcgggcgcctacgtgcggcgtgcgggcgacgacgtgcagcccggtgat
gtggcggtgcgcgcggggacgatcatcggcgcagcccaggtggggttgctggcggcggtc
ggccgtgaacgggtgctggtgcaccctcgtccgcggctgtcggtgatggccgtcgggggc
gagttggtcgacatctcgcggaccccgggcaacgggcaggtttatgacgtcaactcctat
gccttggctgcggcgggccgggatgcctgtgcggaggtgaaccgggttggcatcgtcagc
aacgaccctacggaacttggcgaaatcgtcgagggccagctcaatcgggctgaggtcgtg
gtgatcgccggcggggtgggcggtgcggcggcagaagcggtcaggtcggtgctttccgag
ctcggtgagatggaggtcgtgcgggtcgccatgcatccgggatccgtgcagggcttcgga
cagctcggccgtgatggtgtaccgacctttctgctgccggccaacccggtcagcgccctg
gtggtcttcgaggtgatggttcggccgctgatccggctgtcgctgggtaaacggcatccg
atgcgacggatcgtgtcggcgcgcacgctgtcgccgatcacgtcggtggccgggcgcaag
ggctacctgcgtggccagttgatgcgtgatcaggacagcggcgagtacctggtgcaggcg
ctgggcggcgctccgggggcgtcatcgcacctgctcgcgacgcttgccgaagcgaactgt
ctggttgtggttcccaccggggccgagcagattcgcacgggtgagatcgtggatgtcgcc
ttcctggctcagcacggctga

DBGET integrated database retrieval system