KEGG   Mycobacterium tuberculosis H37Rv: Rv1017cHelp
Entry
Rv1017c           CDS       T00015                                 

Gene name
prsA
Definition
(RefSeq) ribose-phosphate pyrophosphokinase
  KO
K00948  
ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pentose phosphate pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv1017c (prsA)
  Nucleotide metabolism
   00230 Purine metabolism
    Rv1017c (prsA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     Rv1017c (prsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(1135501..1136481)
Genome map
AA seq 326 aa AA seqDB search
MSHDWTDNRKNLMLFAGRAHPELAEQVAKELDVHVTSQDAREFANGEIFVRFHESVRGCD
AFVLQSCPAPVNRWLMEQLIMIDALKRGSAKRITAVMPFYPYARQDKKHRGREPISARLI
ADLLKTAGADRIVTVDLHTDQIQGFFDGPVDHMRGQNLLTGYIRDNYPDGNMVVVSPDSG
RVRIAEKWADALGGVPLAFIHKTRDPRVPNQVVSNRVVGDVAGRTCVLIDDMIDTGGTIA
GAVALLHNDGAGDVIIAATHGVLSDPAAQRLASCGAREVIVTNTLPIGEDKRFPQLTVLS
IAPLLASTIRAVFENGSVTGLFDGDA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
ttgagccacgactggaccgataatcgcaaaaacctgatgctctttgccggccgcgcccat
ccggagctggccgagcaggtagccaaagagctcgacgtccacgtcacctctcaggacgcg
cgggagttcgccaacggcgagatcttcgtgcgcttccacgaatcggtacgcggttgcgac
gccttcgtcctgcaatcctgcccggcaccggtgaacaggtggctgatggaacagctgatc
atgatcgacgcgctcaaacggggcagcgccaaacggatcaccgccgtcatgccgttctat
ccgtatgcccggcaagacaagaaacaccgtggccgcgaaccgatctccgcgcgactgatc
gccgacctgctcaagaccgcgggcgccgaccggatcgtgacggtcgacctgcacaccgac
cagatccagggtttcttcgacgggccggtcgatcatatgcgcggtcagaacctgctgacc
ggttacatcagagacaactacccggacggcaacatggtggtcgtctcccctgactccggc
cgggtacgcatcgccgagaagtgggccgacgcattaggtggtgttcccctcgccttcatc
cacaagacccgtgatccgcgggtacccaaccaagtggtgtccaaccgcgtcgtcggcgac
gtggccgggcgcacctgtgtcctgattgacgacatgatcgacaccggcggcaccatcgcc
ggcgcggtggcattgctgcacaacgacggcgccggtgacgtgatcatcgcggcaacccac
ggcgtgctctccgaccccgctgcgcagcggctggcctcctgcggcgcccgcgaagtgatc
gtcacgaacacgctcccgatcggcgaagacaagcgcttcccccagctcaccgttttgtcc
atcgcgccgctgctggccagcacaatccgggcggtcttcgaaaacggctcagtaacagga
cttttcgacggggacgcatag

DBGET integrated database retrieval system