KEGG   Mycobacterium tuberculosis H37Rv: Rv1070cHelp
Entry
Rv1070c           CDS       T00015                                 

Gene name
echA8
Definition
(RefSeq) enoyl-CoA hydratase EchA8
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00071  Fatty acid degradation
mtu00280  Valine, leucine and isoleucine degradation
mtu00281  Geraniol degradation
mtu00310  Lysine degradation
mtu00360  Phenylalanine metabolism
mtu00362  Benzoate degradation
mtu00380  Tryptophan metabolism
mtu00410  beta-Alanine metabolism
mtu00627  Aminobenzoate degradation
mtu00640  Propanoate metabolism
mtu00650  Butanoate metabolism
mtu00903  Limonene and pinene degradation
mtu00930  Caprolactam degradation
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01212  Fatty acid metabolism
Module
mtu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rv1070c (echA8)
   00650 Butanoate metabolism
    Rv1070c (echA8)
  Lipid metabolism
   00071 Fatty acid degradation
    Rv1070c (echA8)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv1070c (echA8)
   00310 Lysine degradation
    Rv1070c (echA8)
   00360 Phenylalanine metabolism
    Rv1070c (echA8)
   00380 Tryptophan metabolism
    Rv1070c (echA8)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv1070c (echA8)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rv1070c (echA8)
   00281 Geraniol degradation
    Rv1070c (echA8)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rv1070c (echA8)
   00627 Aminobenzoate degradation
    Rv1070c (echA8)
   00930 Caprolactam degradation
    Rv1070c (echA8)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rv1070c (echA8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DUF218
Motif
Other DBs
NCBI-GeneID: 887117
NCBI-ProteinID: NP_215586
TubercuList: Rv1070c
UniProt: P9WNN9 I6X082
Structure
PDB: 

Jmol
Position
complement(1194270..1195043)
Genome map
AA seq 257 aa AA seqDB search
MTYETILVERDQRVGIITLNRPQALNALNSQVMNEVTSAATELDDDPDIGAIIITGSAKA
FAAGADIKEMADLTFADAFTADFFATWGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLI
AADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVV
PADDLLTEARATATTISQMSASAARMAKEAVNRAFESSLSEGLLYERRLFHSAFATEDQS
EGMAAFIEKRAPQFTHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacgaaaccatcctggtcgagcgcgatcagcgagttggcattatcacgctgaac
cgtccccaggcactgaacgcgctcaacagccaggtgatgaacgaggtcaccagcgctgca
accgaactggacgatgacccggacattggggcgatcatcatcaccggttcggccaaagcg
tttgccgccggagccgacatcaaagaaatggccgacctgacgttcgccgacgcgttcacc
gccgacttcttcgccacctggggcaagctggccgccgtgcgcaccccgacgatcgccgcg
gtggcgggatacgcgctcggcggtggctgcgagctggcgatgatgtgcgacgtgctgatc
gccgccgacaccgcgaagttcggacagcccgagataaagctgggcgtgctgccaggcatg
ggcggctcccagcggctgacccgggctatcggcaaggctaaggcgatggacctcatcctg
accgggcgcaccatggacgccgccgaggccgagcgcagcggtctggtttcacgggtggtg
ccggccgacgacttgctgaccgaagccagggccactgccacgaccatttcgcagatgtcg
gcctcggcggcccggatggccaaggaggccgtcaaccgggctttcgaatccagtttgtcc
gaggggctgctctacgaacgccggcttttccattcggctttcgcgaccgaagaccaatcc
gaaggtatggcagcgttcatcgagaaacgcgctccccagttcacccaccgatga

DBGET integrated database retrieval system