KEGG   Mycobacterium tuberculosis H37Rv: Rv1077Help
Entry
Rv1077            CDS       T00015                                 

Gene name
cbs
Definition
(RefSeq) cystathionine beta-synthase
  KO
K01697  
cystathionine beta-synthase [EC:4.2.1.22]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1077 (cbs)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1077 (cbs)
   00270 Cysteine and methionine metabolism
    Rv1077 (cbs)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     Rv1077 (cbs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1201717..1203111
Genome map
AA seq 464 aa AA seqDB search
MRIAQHISELIGGTPLVRLNSVVPDGAGTVAAKVEYLNPGGSSKDRIAVKMIEAAEASGQ
LKPGGTIVEPTSGNTGVGLALVAQRRGYKCVFVCPDKVSEDKRNVLIAYGAEVVVCPTAV
PPHDPASYYSVSDRLVRDIDGAWKPDQYANPEGPASHYVTTGPEIWADTEGKVTHFVAGI
GTGGTITGAGRYLKEVSGGRVRIVGADPEGSVYSGGAGRPYLVEGVGEDFWPAAYDPSVP
DEIIAVSDSDSFDMTRRLAREEAMLVGGSCGMAVVAALKVAEEAGPDALIVVLLPDGGRG
YMSKIFNDAWMSSYGFLRSRLDGSTEQSTVGDVLRRKSGALPALVHTHPSETVRDAIGIL
REYGVSQMPVVGAEPPVMAGEVAGSVSERELLSAVFEGRAKLADAVSAHMSPPLRMIGAG
ELVSAAGKALRDWDALMVVEEGKPVGVITRYDLLGFLSEGAGRR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcgcgcaacatatcagtgaactcattggtggtaccccactggttcggctgaac
tccgtggtacccgacggcgccggaaccgtggccgcaaaggtcgagtatctcaaccctggc
ggcagctccaaggatcggatcgcggtgaagatgatcgaagccgccgaggccagcggtcag
ctgaagccgggtggcaccatcgtcgaacccacgtccggcaataccggcgttggtctggcg
ttggtcgctcagcgccgcggctacaagtgcgtgttcgtctgcccggacaaggtcagtgag
gataaacgcaatgtgttgatcgcctacggcgccgaggtcgtggtgtgcccgacggcggtc
ccgccgcacgatccggccagctactacagtgtgtcggaccggttggtccgtgatatcgac
ggtgcctggaagcccgaccagtacgccaacccggagggaccggcaagccattatgtgacc
accggcccggaaatctgggccgataccgagggcaaggtcacccatttcgtggctggcatc
ggcaccggcggtaccatcaccggcgctggccggtacctcaaagaggtgtccgggggccga
gtacgcatcgtcggcgccgacccggagggatcggtctattcgggcggtgccggccgaccg
tatctggtcgagggggtcggcgaggatttctggccggcggcctatgacccgagcgtgccc
gacgagatcatcgcggtgtccgactccgactcgttcgacatgaccaggcggctggcccgc
gaagaggcgatgttggtcggcgggtcgtgcgggatggcggtggttgccgcgctcaaggtc
gccgaggaagccgggcccgacgcgttgatcgtcgtcctgttgcccgacggcggccggggc
tacatgtcgaaaatcttcaacgacgcgtggatgtcgtcctatgggttcctgcgcagccgc
cttgacgggtcgaccgagcaatccaccgtcggtgatgtgttgcgccgcaagtccggcgcg
ctgcccgccctggtgcacacccatccgtcggagaccgtgcgcgacgccatcgggattctt
cgcgagtacggggtgtcgcagatgccggtggtcggcgccgagccgccggtgatggccggc
gaggtcgccggtagcgtctcggaacgcgagctgctctcggccgtgttcgagggccgcgcc
aagttggccgacgccgtgtcggcacacatgagcccgccgctgcggatgataggcgccggt
gaattggtcagtgcggccggcaaggcgttgcgtgattgggatgcgttgatggtggtggag
gaaggcaagccggttggggtcattacccggtacgacttgttgggcttcttgtcggagggg
gcgggacggcggtag

DBGET integrated database retrieval system