KEGG   Mycobacterium tuberculosis H37Rv: Rv1079Help
Entry
Rv1079            CDS       T00015                                 

Gene name
metB
Definition
(RefSeq) cystathionine gamma-synthase
  KO
K01739  
cystathionine gamma-synthase [EC:2.5.1.48]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1079 (metB)
  Energy metabolism
   00920 Sulfur metabolism
    Rv1079 (metB)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv1079 (metB)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rv1079 (metB)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     Rv1079 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1204067..1205233
Genome map
AA seq 388 aa AA seqDB search
MSEDRTGHQGISGPATRAIHAGYRPDPATGAVNVPIYASSTFAQDGVGGLRGGFEYARTG
NPTRAALEASLAAVEEGAFARAFSSGMAATDCALRAMLRPGDHVVIPDDAYGGTFRLIDK
VFTRWDVQYTPVRLADLDAVGAAITPRTRLIWVETPTNPLLSIADITAIAELGTDRSAKV
LVDNTFASPALQQPLRLGADVVLHSTTKYIGGHSDVVGGALVTNDEELDEEFAFLQNGAG
AVPGPFDAYLTMRGLKTLVLRMQRHSENACAVAEFLADHPSVSSVLYPGLPSHPGHEIAA
RQMRGFGGMVSVRMRAGRRAAQDLCAKTRVFILAESLGGVESLIEHPSAMTHASTAGSQL
EVPDDLVRLSVGIEDIADLLGDLEQALG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaccgcacgggacaccagggaatcagcggaccggccacccgcgccatccac
gctggctaccgcccggatccggcgaccggggcggtgaacgtgccgatctacgccagcagc
accttcgcccaagacggcgtcggcggtctgcgtggcggtttcgaatacgcacgcaccggc
aaccccacccgggccgcattggaggcctcgctggcggcagtcgaggagggtgctttcgcg
cgggcattcagttccgggatggccgcgaccgactgcgccctgcgggcgatgttacggccc
ggagaccacgtcgtcattcccgatgacgcctacggcggcacattccggttgatagacaag
gtgttcacccggtgggatgtccagtacacgccggtgcggcttgccgatctggatgcggtg
ggtgccgcgattactccgcgcacccggctgatttgggtggagacgcccaccaatccgcta
ctgtcgatcgccgatatcacggccattgccgagctgggcacagacagatcggcaaaagta
ttggtggacaatacctttgcctcacccgcgttgcagcagccgttgcggctgggcgccgat
gtggtgttgcactcgactaccaagtacatcggcggccattccgacgtggtgggaggtgcg
ctggtcaccaacgacgaagagctggacgaggagttcgctttcttgcagaacggcgccggc
gcggtgcccggaccattcgacgcctacctgaccatgcgcggcctgaagaccttggtgctg
cggatgcagcggcacagtgaaaatgcctgtgcggtagcggaattcctcgctgatcatccg
tcggtgagttctgtgttgtatccgggtttgcccagtcatcccgggcatgagattgccgcg
cgacagatgcgcggcttcggcggcatggtttcggtgcggatgcgggccggtcggcgtgcg
gcgcaggacctgtgtgccaagacccgcgtcttcatcctggccgagtcgctgggtggggtg
gagtcgctgatcgaacatcccagcgccatgacccatgcgtcgacggccggttcgcaattg
gaggtgcccgacgatctggtgcggctttcggtcggtatcgaagacattgccgacctgctc
ggcgatctcgaacaggccctgggttaa

DBGET integrated database retrieval system