KEGG   Mycobacterium tuberculosis H37Rv: Rv1082Help
Entry
Rv1082            CDS       T00015                                 

Gene name
mca
Definition
(RefSeq) mycothiol S-conjugate amidase
  KO
K18455  
mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     Rv1082 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1206520..1207386
Genome map
AA seq 288 aa AA seqDB search
MSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNPAMDLPDVHGR
IAEIRRDEMTKAAEILGVEHTWLGFVDSGLPKGDLPPPLPDDCFARVPLEVSTEALVRVV
REFRPHVMTTYDENGGYPHPDHIRCHQVSVAAYEAAGDFCRFPDAGEPWTVSKLYYVHGF
LRERMQMLQDEFARHGQRGPFEQWLAYWDPDHDFLTSRVTTRVECSKYFSQRDDALRAHA
TQIDPNAEFFAAPLAWQERLWPTEEFELARSRIPARPPETELFAGIEP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactgcggttgatggcggtgcacgcccaccccgatgacgagtccagcaagggc
gcggccaccctggcgcgctacgccgacgagggtcatcgcgtgctggtggtgacgttgacc
ggtggtgagcgcggcgagatcctcaacccggcgatggacctgccggacgtgcatgggcgc
atcgccgagatccggcgtgacgagatgaccaaggcggccgagatcctcggtgtcgagcac
acctggctgggcttcgtcgactccgggctacctaagggtgatttaccgccaccgctgcct
gatgactgcttcgcgcgggtaccgctggaggtgtccaccgaggcgctggtgcgggtggtt
cgcgagtttcggccgcacgtgatgaccacctacgacgagaacggcggctacccacatccc
gaccacattcgctgccatcaggtttcggtggctgcctacgaggcggccggtgacttttgc
cggtttcccgacgcgggtgagccgtggacggtgtccaagctgtactacgtccacggcttc
ctgcgggagcggatgcagatgttgcaggatgagttcgcccggcacggccaacgcggccca
ttcgaacaatggctggcgtactgggaccccgaccatgactttctcaccagccgagtgacc
acccgggtcgagtgctcgaaatacttcagccaacgcgacgatgcgttgcgcgcgcatgcc
acccagatcgacccgaacgccgaattcttcgccgccccgcttgcctggcaggagcggctg
tggccgaccgaggaattcgagttggctcgctcgcgtatccccgcgcgcccaccggagacc
gaattgttcgccgggatcgagccgtga

DBGET integrated database retrieval system