KEGG   Mycobacterium tuberculosis H37Rv: Rv1086Help
Entry
Rv1086            CDS       T00015                                 

Definition
(RefSeq) (2Z,6E)-farnesyl diphosphate synthase
  KO
K12503  
short-chain Z-isoprenyl diphosphate synthase [EC:2.5.1.68]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Terpenoid backbone biosynthesis
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rv1086
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.68  (2Z,6E)-farnesyl diphosphate synthase
     Rv1086
Prenyltransferases [BR:mtu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Rv1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1210595..1211383
Genome map
AA seq 262 aa AA seqDB search
MEIIPPRLKEPLYRLYELRLRQGLAASKSDLPRHIAVLCDGNRRWARSAGYDDVSYGYRM
GAAKIAEMLRWCHEAGIELATVYLLSTENLQRDPDELAALIEIITDVVEEICAPANHWSV
RTVGDLGLIGEEPARRLRGAVESTPEVASFHVNVAVGYGGRREIVDAVRALLSKELANGA
TAEELVDAVTVEGISENLYTSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTEAHWPA
FRHVDFLRALRDYSARHRSYGR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtggagatcatcccgccgcggctcaaagagccgttgtaccggctctacgagctgcgcctg
cggcagggcttggccgcctcgaaatccgacctgccccggcacatagccgtgctgtgcgac
ggcaaccggcgatgggcgcgcagcgcgggctacgacgacgtcagctacggctaccggatg
ggtgcggccaagatcgccgaaatgctgcggtggtgccacgaagccggcatcgaactggcc
accgtctatctgctgtccaccgaaaacctgcagcgcgatcccgacgagcttgcagcactc
atcgagatcatcaccgatgtcgtggaagagatctgcgcaccggccaaccactggagtgtg
cggacggtcggggatctggggttgatcggcgaggaaccggcccggcggctgcgcggtgcg
gtggaatccaccccggaggtggcctcgtttcatgtcaacgttgctgttggctacggcggg
cgccgcgagatcgtcgacgctgtgcgcgcgttgttgagcaaggaactcgccaacggggcc
accgcggaggaactcgtcgacgcggtgaccgtcgagggtatctcggaaaacctgtacacc
tcaggccaacccgaccccgatttggtgatacgcacctccggcgagcaacgcttgtccggg
ttcttgctgtggcaaagcgcctactcggagatgtggttcaccgaggcgcactggccggcg
tttcgccacgtcgattttctacgcgcgctgcgtgactacagtgcgaggcatcgcagctac
ggcaggtga

DBGET integrated database retrieval system