KEGG   Mycobacterium tuberculosis H37Rv: Rv1092cHelp
Entry
Rv1092c           CDS       T00015                                 

Gene name
coaA
Definition
(RefSeq) pantothenate kinase
  KO
K00867  
type I pantothenate kinase [EC:2.7.1.33]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv1092c (coaA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     Rv1092c (coaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1219248..1220186)
Genome map
AA seq 312 aa AA seqDB search
MSRLSEPSPYVEFDRRQWRALRMSTPLALTEEELVGLRGLGEQIDLLEVEEVYLPLARLI
HLQVAARQRLFAATAEFLGEPQQNPDRPVPFIIGVAGSVAVGKSTTARVLQALLARWDHH
PRVDLVTTDGFLYPNAELQRRNLMHRKGFPESYNRRALMRFVTSVKSGSDYACAPVYSHL
HYDIIPGAEQVVRHPDILILEGLNVLQTGPTLMVSDLFDFSLYVDARIEDIEQWYVSRFL
AMRTTAFADPESHFHHYAAFSDSQAVVAAREIWRTINRPNLVENILPTRPRATLVLRKDA
DHSINRLRLRKL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggcttagcgagccgagcccatatgtcgagttcgaccgaaggcagtggcgcgcg
ctccgtatgtcgactccgctagccctcaccgaagaagaactggttggcctgcgcggtctc
ggtgagcagatcgacctgttggaggtcgaagaggtctacctaccgctggcccggctgatt
cacctgcaagtcgccgcccgccaacggctgttcgcggccaccgcggaatttctcggcgag
ccccaacaaaacccggaccggccggtgccgttcatcatcggtgtggccggcagtgtggcg
gtcggcaagtccaccaccgcccgcgtgctgcaggcgctgctggctcgctgggatcaccac
ccccgggtagatctggtgaccaccgacggctttctctaccccaacgccgagctgcagcgg
cgaaacctcatgcatcgcaaaggttttccggaaagctataaccgccgggcactgatgcgg
tttgtcacctcggtgaagtccggctccgactacgcatgtgcgccggtgtattcgcatttg
cactacgacatcatcccgggggcagaacaagtggtccgccatcccgacatcctgatcctg
gaggggctcaacgtcttgcagaccggccccacgctcatggtgtcggatctgttcgatttt
tcgttgtatgtagacgcccggatcgaggacatcgagcagtggtacgtatcacggtttttg
gccatgcgcaccacggcgttcgccgacccggaatcacacttccaccactacgcggctttt
tctgactcgcaggccgtcgtcgccgcgcgcgagatctggcggaccatcaaccggcccaac
ctcgtggagaacattctgccgacccgtccccgggccaccctggtgctgcgcaaggacgcc
gatcattccattaaccggctgcggctgcgcaagctgtaa

DBGET integrated database retrieval system