KEGG   Mycobacterium tuberculosis H37Rv: Rv1093Help
Entry
Rv1093            CDS       T00015                                 

Gene name
glyA1
Definition
(RefSeq) serine hydroxymethyltransferase
  KO
K00600  
glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Cyanoamino acid metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv1093 (glyA1)
   01230 Biosynthesis of amino acids
    Rv1093 (glyA1)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1093 (glyA1)
  Energy metabolism
   00680 Methane metabolism
    Rv1093 (glyA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1093 (glyA1)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Rv1093 (glyA1)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rv1093 (glyA1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     Rv1093 (glyA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1220574..1221854
Genome map
AA seq 426 aa AA seqDB search
MSAPLAEVDPDIAELLAKELGRQRDTLEMIASENFVPRAVLQAQGSVLTNKYAEGLPGRR
YYGGCEHVDVVENLARDRAKALFGAEFANVQPHSGAQANAAVLHALMSPGERLLGLDLAN
GGHLTHGMRLNFSGKLYENGFYGVDPATHLIDMDAVRATALEFRPKVIIAGWSAYPRVLD
FAAFRSIADEVGAKLLVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGGRSGLIVGK
QQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEFADRQRRTLSGARIIADRLMAP
DVAKAGVSVVSGGTDVHLVLVDLRDSPLDGQAAEDLLHEVGITVNRNAVPNDPRPPMVTS
GLRIGTPALATRGFGDTEFTEVADIIATALATGSSVDVSALKDRATRLARAFPLYDGLEE
WSLVGR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccccgctcgctgaggttgaccccgatatcgccgagttgctggccaaggagctt
ggtcggcaacgagacaccctggagatgatcgcctcggagaacttcgtaccgcgcgctgtg
ctgcaggcccagggcagtgtgctgaccaacaagtacgccgagggactgcccgggcggcgc
tactacggcggttgtgagcacgtcgacgtggtggaaaacctcgcccgcgaccgagccaag
gcgttgttcggtgccgaattcgccaatgtgcaaccgcattcgggcgctcaggccaacgcc
gcggtgctgcatgcgctgatgtcacccggcgagcggctgttgggtctggacctggccaac
ggtggtcacctgacccatggcatgcggctgaacttctccggcaagctctacgagaatggc
ttctacggcgtcgacccggcgacacatctgatcgacatggatgcggtgcgggccaccgca
ctcgaattccgcccgaaggtgatcatcgccggctggtcggcctacccgcgggtgctcgac
ttcgcggcgttccggtcgatcgccgacgaggtcggggccaagttgctcgtggacatggcg
catttcgcgggtctggtcgccgcggggttgcacccgtcgccggtgccgcacgcggatgtg
gtgtccaccaccgtgcacaagacgctcggcggcggccgctccggcctgatcgtcggtaag
cagcagtacgccaaggcgatcaactcggcggtgtttcccgggcagcagggcggtccgctc
atgcacgtcattgccggcaaggcggtcgcgttgaagatcgccgccacacccgaatttgcc
gaccggcagcggcgcacgctgtccggggcccggatcattgccgatcgactgatggctccc
gatgtcgccaaggccggtgtgtcggtggtcagcggcggcaccgacgtccacctggtgctg
gtcgatctgcgtgattccccactggatggccaggccgccgaggacctgctgcacgaggtc
ggcatcacggtcaaccgcaacgccgtccccaatgatccccgaccgccgatggtgacctcg
ggcctgcggataggcacgcccgcgctggcgacccgcggcttcggcgacaccgagttcacc
gaggtcgccgacattattgcgaccgcgctggcgaccggcagttccgttgatgtgtcggcg
cttaaggatcgggcgacccggctggccagggcgtttccgctctacgacgggctcgaggag
tggagtctggtcggccgctga

DBGET integrated database retrieval system