KEGG   Mycobacterium tuberculosis H37Rv: Rv1098cHelp
Entry
Rv1098c           CDS       T00015                                 

Gene name
fum
Definition
(RefSeq) fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00020  Citrate cycle (TCA cycle)
mtu00620  Pyruvate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv1098c (fum)
   00620 Pyruvate metabolism
    Rv1098c (fum)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     Rv1098c (fum)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 FumaraseC_C
Motif
Other DBs
NCBI-GeneID: 885651
NCBI-ProteinID: NP_215614
TubercuList: Rv1098c
UniProt: P9WN93 I6X0B1
Structure
PDB: 

Jmol
Position
complement(1226141..1227565)
Genome map
AA seq 474 aa AA seqDB search
MAVDADSANYRIEHDTMGEVRVPAKALWRAQTQRAVENFPISGRGLERTQIRALGLLKGA
CAQVNSDLGLLAPEKADAIIAAAAEIADGQHDDQFPIDVFQTGSGTSSNMNTNEVIASIA
AKGGVTLHPNDDVNMSQSSNDTFPTATHIAATEAAVAHLIPALQQLHDALAAKALDWHTV
VKSGRTHLMDAVPVTLGQEFSGYARQIEAGIERVRACLPRLGELAIGGTAVGTGLNAPDD
FGVRVVAVLVAQTGLSELRTAANSFEAQAARDGLVEASGALRTIAVSLTKIANDIRWMGS
GPLTGLAEIQLPDLQPGSSIMPGKVNPVLPEAVTQVAAQVIGNDAAIAWGGANGAFELNV
YIPMMARNILESFKLLTNVSRLFAQRCIAGLTANVEHLRRLAESSPSIVTPLNSAIGYEE
AAAVAKQALKERKTIRQTVIDRGLIGDRLSIEDLDRRLDVLAMAKAEQLDSDRL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgacgccgacagcgccaattaccgcatcgagcacgacaccatgggcgaagtc
cgggtgccggcaaaagcgttgtggcgcgcgcaaacccagcgcgcggtggagaacttcccg
atatccggccgcgggttggagcgcacccagatccgcgcgctaggcctgctgaaaggcgcc
tgcgcgcaggtgaactccgacctcgggttgctggcgccggagaaagccgacgccatcatc
gccgcggccgccgagatcgccgacggtcaacacgacgaccagtttcccatcgacgtcttc
cagaccggctcgggcaccagctccaacatgaacaccaacgaggtgattgcgtccatcgcg
gccaagggcggggtcacgttgcatcccaacgacgacgtgaacatgtcgcagtcgtccaac
gacaccttcccgacggccacccacatcgcggccaccgaggccgcggtcgctcatctcatc
ccagcgctgcagcagctgcacgacgcattggccgccaaggctcttgattggcacacggtg
gtgaagtcgggccgaacgcatctgatggacgccgttccggtgacactcggccaggagttc
agcggatatgcccgccagatcgaggccggcatcgagcgggtgcgcgcgtgtctgcccagg
ctgggcgagctggcgatcggcggcaccgcggtgggtaccggcctcaacgctcccgacgac
ttcggcgtcagagtggtcgcggtgctggtcgcgcagaccggtctgtcggaattgcgtacg
gcggctaattctttcgaagctcaggctgcccgcgacgggctggtggaggcgtccggggcg
ctgcgcacgatcgcggtatcgctgaccaagatcgccaacgacatccgctggatgggatcg
ggcccattgaccggcctggccgagatccaactgccagatctgcagccgggcagctcgatc
atgccgggaaaggtgaatccggttctgccggaggcggttacgcaggtcgccgcgcaggtg
atcggaaacgacgccgccatcgcctggggtggggccaacggcgcattcgaactcaacgtc
tacatcccgatgatggcccgcaacatcctcgagtccttcaagctgctgaccaatgtgtca
cggctgttcgcccagcgctgcatagcagggctgaccgccaacgtcgagcacctgcggcgg
ctggccgagtcctcaccgtcgatcgtgacaccgttgaattcggccatcggctacgaggag
gcggccgccgtcgccaagcaagcactcaaggaacgcaaaacgattcgccaaaccgtgatc
gaccgtggcctgatcggcgacaggctgtcgatcgaggatctggaccgccgtctggacgtg
ctggcaatggccaaggccgagcagctcgacagcgatcggctatga

DBGET integrated database retrieval system