KEGG   Mycobacterium tuberculosis H37Rv: Rv1098cHelp
Entry
Rv1098c           CDS       T00015                                 

Gene name
fum
Definition
(RefSeq) fumarate hydratase
  KO
K01679  
fumarate hydratase, class II [EC:4.2.1.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv1098c (fum)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv1098c (fum)
   00620 Pyruvate metabolism
    Rv1098c (fum)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     Rv1098c (fum)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1226141..1227565)
Genome map
AA seq 474 aa AA seqDB search
MAVDADSANYRIEHDTMGEVRVPAKALWRAQTQRAVENFPISGRGLERTQIRALGLLKGA
CAQVNSDLGLLAPEKADAIIAAAAEIADGQHDDQFPIDVFQTGSGTSSNMNTNEVIASIA
AKGGVTLHPNDDVNMSQSSNDTFPTATHIAATEAAVAHLIPALQQLHDALAAKALDWHTV
VKSGRTHLMDAVPVTLGQEFSGYARQIEAGIERVRACLPRLGELAIGGTAVGTGLNAPDD
FGVRVVAVLVAQTGLSELRTAANSFEAQAARDGLVEASGALRTIAVSLTKIANDIRWMGS
GPLTGLAEIQLPDLQPGSSIMPGKVNPVLPEAVTQVAAQVIGNDAAIAWGGANGAFELNV
YIPMMARNILESFKLLTNVSRLFAQRCIAGLTANVEHLRRLAESSPSIVTPLNSAIGYEE
AAAVAKQALKERKTIRQTVIDRGLIGDRLSIEDLDRRLDVLAMAKAEQLDSDRL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgacgccgacagcgccaattaccgcatcgagcacgacaccatgggcgaagtc
cgggtgccggcaaaagcgttgtggcgcgcgcaaacccagcgcgcggtggagaacttcccg
atatccggccgcgggttggagcgcacccagatccgcgcgctaggcctgctgaaaggcgcc
tgcgcgcaggtgaactccgacctcgggttgctggcgccggagaaagccgacgccatcatc
gccgcggccgccgagatcgccgacggtcaacacgacgaccagtttcccatcgacgtcttc
cagaccggctcgggcaccagctccaacatgaacaccaacgaggtgattgcgtccatcgcg
gccaagggcggggtcacgttgcatcccaacgacgacgtgaacatgtcgcagtcgtccaac
gacaccttcccgacggccacccacatcgcggccaccgaggccgcggtcgctcatctcatc
ccagcgctgcagcagctgcacgacgcattggccgccaaggctcttgattggcacacggtg
gtgaagtcgggccgaacgcatctgatggacgccgttccggtgacactcggccaggagttc
agcggatatgcccgccagatcgaggccggcatcgagcgggtgcgcgcgtgtctgcccagg
ctgggcgagctggcgatcggcggcaccgcggtgggtaccggcctcaacgctcccgacgac
ttcggcgtcagagtggtcgcggtgctggtcgcgcagaccggtctgtcggaattgcgtacg
gcggctaattctttcgaagctcaggctgcccgcgacgggctggtggaggcgtccggggcg
ctgcgcacgatcgcggtatcgctgaccaagatcgccaacgacatccgctggatgggatcg
ggcccattgaccggcctggccgagatccaactgccagatctgcagccgggcagctcgatc
atgccgggaaaggtgaatccggttctgccggaggcggttacgcaggtcgccgcgcaggtg
atcggaaacgacgccgccatcgcctggggtggggccaacggcgcattcgaactcaacgtc
tacatcccgatgatggcccgcaacatcctcgagtccttcaagctgctgaccaatgtgtca
cggctgttcgcccagcgctgcatagcagggctgaccgccaacgtcgagcacctgcggcgg
ctggccgagtcctcaccgtcgatcgtgacaccgttgaattcggccatcggctacgaggag
gcggccgccgtcgccaagcaagcactcaaggaacgcaaaacgattcgccaaaccgtgatc
gaccgtggcctgatcggcgacaggctgtcgatcgaggatctggaccgccgtctggacgtg
ctggcaatggccaaggccgagcagctcgacagcgatcggctatga

DBGET integrated database retrieval system