KEGG   Mycobacterium tuberculosis H37Rv: Rv1122Help
Entry
Rv1122            CDS       T00015                                 

Gene name
gnd2
Definition
(RefSeq) 6-phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  
6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv1122 (gnd2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rv1122 (gnd2)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     Rv1122 (gnd2)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     Rv1122 (gnd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1245129..1246151
Genome map
AA seq 340 aa AA seqDB search
MQLGMIGLGRMGANIVRRLAKGGHDCVVYDHDPDAVKAMAGEDRTTGVASLRELSQRLSA
PRVVWVMVPAGNITTAVIEELANTLEAGDIVIDGGNTYYRDDLRHEKLLFKKGIHLLDCG
TSGGVWGRERGYCLMIGGDGDAFARAEPIFATVAPGVAAAPRTPGRDGEVAPSEQGYLHC
GPCGSGHFVKMVHNGIEYGMMASLAEGLNILRNADVGTRVQHGDAETAPLPNPECYQYDF
DIPEVAEVWRRGSVIGSWLLDLTAIALRESPDLAEFSGRVSDSGEGRWTAIAAIDEGVPA
PVLTTALQSRFASRDLDDFANKALSAMRKQFGGHAEKPAN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaggaatgatcggtctgggccggatgggtgcgaatatcgtccgccgcttggcc
aaaggtggacacgactgcgtggtctacgaccacgaccccgacgcggtcaaggcgatggcc
ggggaggaccggaccaccggggtggcctcgttgcgtgagttgtctcagcggctctccgcc
ccgcgagttgtctgggtgatggtgcccgcggggaacatcaccaccgcggtgatcgaagag
ctggccaacacgctcgaggccggcgacattgtgatcgacggtggcaacacctattatcgc
gacgatctgcggcacgaaaagctgttgttcaagaagggaattcacctactcgactgtggc
accagcggcggtgtgtggggtcgggaacgtggctactgcctgatgatcggcggggatggc
gacgcgttcgcgcgcgcggagccgatcttcgccaccgtcgcgccgggggtggcggccgcc
ccgcgcaccccgggccgagacggtgaggtcgcgccatcggaacaaggctatttgcattgt
gggccttgcggttcgggtcacttcgtgaagatggtccacaacggcatcgaatacgggatg
atggcctccttggcggagggattgaacatcctgcgcaatgccgacgtcggcacccgcgtg
caacacggtgacgccgaaaccgcgccgctgccgaatcccgagtgctaccagtacgacttc
gacatcccggaggtcgccgaggtatggcggcggggcagcgtgatcggctcctggctgctg
gatttgaccgcgatcgcgctgcgcgaatcacctgacctagcggaattctccggacgggtc
tccgactctggcgagggccggtggaccgccatcgcggcgatcgacgagggcgtgcccgcg
ccggtgctgaccaccgcgctgcagtcccgcttcgcctcgcgtgacctcgacgacttcgcc
aacaaggcgctgtcggcgatgcgcaagcagttcggcggacacgccgagaaaccggctaac
taa

DBGET integrated database retrieval system