KEGG   Mycobacterium tuberculosis H37Rv: Rv1127cHelp
Entry
Rv1127c           CDS       T00015                                 

Gene name
ppdK
Definition
(RefSeq) pyruvate, phosphate dikinase PpdK
  KO
K01006  
pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv1127c (ppdK)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rv1127c (ppdK)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.1  pyruvate, phosphate dikinase
     Rv1127c (ppdK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(1249932..1251404)
Genome map
AA seq 490 aa AA seqDB search
MTRITRANGCPDGTLENAVVALDGGANYPREILGNKGHGIDMMRRHHLPVPPAFCITTEV
GVRYLAAPGSTIAAIWDDVLDRMSWLETETSCTFGRGPNPLLVSVRSGATQSMPGMMDTI
LDVGMTDAVERVLARPGAADFAHDTRRRFTSMYRRIVGSAGPITDDPYAQLRASIEAVFA
SWNSPRAVAYRDHHGLDDQGGTAVVVQAMVFGNLTANSGAGVLSSRNPITGANEPFGEWL
PGGQGDDVVSGLVAVAPITALRDQQPAVYDQLMAAARSLERMAGDVQEIEFTVEDSQLWL
LQTRGAERSAQAAVRLALQLHHEGLIDDTETLRRVTPTHIETLLRPSLQTETRLAAPLLA
KGLPACPGVVSGTAYTEVDEALDAADRGEPVILVRDHTRPEDVMGMLAAQGIVTEVGGAA
SHAAVVSRELGRVAVVGCGPGVAAALAGKEITVDGYEGEVRQGVLALSAWSESDTPELRE
LADIAQRISS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtatcacccgagccaatggttgccccgacggaactctcgaaaacgccgttgtg
gcgctggacggcggcgcgaactacccacgcgagatcctgggcaacaaaggccacggcatc
gacatgatgcgccggcaccatctgccggtgccgcctgcattctgcattaccaccgaggtg
ggcgtgcgctatctcgccgcgcccggatccacgatcgccgcgatctgggatgacgtgctg
gatcggatgagctggctggaaacagaaacctcgtgcacgttcggccgtggcccgaatccg
ctgctggtcagcgtgcgctcgggagccacccagtcgatgcccggcatgatggacacgatt
ctggacgtgggcatgaccgacgcggtcgaacgagtacttgccaggccgggtgccgccgac
ttcgcccacgacaccagacggcgattcaccagcatgtatcggcgcatcgtcggcagcgcc
ggtcccattaccgacgacccgtatgcccagttgcgcgcgagcatcgaggcggtattcgcc
tcctggaactcacctcgcgccgttgcctatcgcgaccatcacggcctcgacgaccaaggc
ggtacggcggtggtggtgcaggcgatggtattcggcaacctcaccgcgaactcgggcgcc
ggggtgctgtcctcacgcaacccgatcaccggagccaacgaaccgttcggcgaatggcta
cccggcggccaaggcgacgacgtggtgtccggattggtcgccgtcgcaccgatcaccgcc
ctgcgcgaccagcagccggccgtctacgaccaactgatggcggccgcccgcagtttggag
cgcatggcaggcgacgtccaggagatcgaattcaccgtggaggacagccagctgtggctg
ctgcagacccgcggggcggaacgctcggcgcaggccgccgtgcgactggcgctgcaactg
catcacgagggactcatcgacgacaccgagacactgcgccgggtgactccgacgcacatc
gagactttgctacggccgtcgctgcagacggaaacacggttggctgcaccgcttttggcc
aagggcctgcccgcttgcccgggcgtggtatccgggaccgcctacaccgaggtggacgag
gcgctggacgctgcggaccggggcgagccggtcatcttggtgcgagatcacaccagaccg
gaggacgtcatgggcatgcttgccgcgcaaggcattgtcaccgaggtggggggtgccgcc
agtcatgcggcggtggttagccgcgagctcggtcgagtggccgtggtgggttgcggtccc
ggggtcgcggcggcactggccggcaaggagatcaccgtcgacggctatgaaggcgaagtg
cgccaaggcgttctggcattgtctgcctggtcggaaagtgacacgccggagttgcgcgag
ctggccgacatcgcgcaacggatcagttcatga

DBGET integrated database retrieval system