KEGG   Mycobacterium tuberculosis H37Rv: Rv1130Help
Entry
Rv1130            CDS       T00015                                 

Gene name
prpD
Definition
(RefSeq) 2-methylcitrate dehydratase
  KO
K01720  
2-methylcitrate dehydratase [EC:4.2.1.79]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rv1130 (prpD)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.79  2-methylcitrate dehydratase
     Rv1130 (prpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1254555..1256135
Genome map
AA seq 526 aa AA seqDB search
MPDQDTKVRFFRVFCWCPVLRMVRIMLMHAVRAWRSADDFPCTEHMAYKIAQVAADPVDV
DPEVADMVCNRIIDNAAVSAASMVRRPVTVARHQALAHPVRHGAKVFGVEGSYSADWAAW
ANGVAARELDFHDTFLAADYSHPADNIPPLVAVAQQLGVCGAELIRGLVTAYEIHIDLTR
GICLHEHKIDHVAHLGPAVAAGIGTMLRLDQETIYHAIGQALHLTTSTRQSRKGAISSWK
AFAPAHAGKVGIEAVDRAMRGEGSPAPIWEGEDGVIAWLLAGPEHTYRVPLPAPGEPKRA
ILDSYTKQHSAEYQSQAPIDLACRLRERIGDLDQIASIVLHTSHHTHVVIGTGSGDPQKF
DPDASRETLDHSLPYIFAVALQDGCWHHERSYAPERARRSDTVALWHKISTVEDPEWTRR
YHCADPAKKAFGARAEVTLHSGEVIVDELAVADAHPLGTRPFERKQYVEKFTELADGVVE
PVEQQRFLAVVESLADLESGAVGGLNVLVDPRVLDKAPVIPPGIFR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgccggatcaggacacaaaagtacgctttttcagggtcttttgttggtgtcctgtgctg
cgtatggtgcggattatgttgatgcatgcggtccgggcgtggcgcagcgccgacgatttc
ccgtgcaccgagcacatggcctacaagatcgcccaggtggctgccgatccggttgacgtc
gacccggaggtagcggacatggtgtgcaaccgcatcatcgacaacgctgcggtgagcgcc
gcatcaatggtgcgcagaccggtcaccgtggcccgccaccaggcactggcgcatccggtg
cgacacggggcgaaggtatttggcgtcgagggcagctactcggcggactgggcggcctgg
gccaacggcgtcgccgcgcgtgaacttgactttcacgacacgtttctggccgccgactat
tcgcacccggcggacaacatacccccactggtggcggtcgcccagcagctcggcgtgtgc
ggcgcggagctgatccgcggtctggtaaccgcctatgagatccacatcgacctaacccgc
ggaatctgcttgcacgagcacaagatcgaccatgtcgcccacctgggcccggcggtggcc
gccggcatcgggaccatgctgcggctcgaccaagagaccatctaccacgcgatcggccag
gccctgcatctgaccaccagcacccgtcaatcccgcaagggcgccatctccagctggaag
gcgttcgcgccggcgcatgccggcaaggtcggcatcgaggcggtcgatcgggcgatgcgc
ggcgagggctcaccggctccgatctgggagggcgaggacggggtgatcgcctggctgctg
gccggacccgagcacacctaccgggtgccgttgcccgcacctggtgaacccaagcgcgcc
attctggacagctacaccaagcaacactccgcggagtaccagagccaggcgccgatcgac
ctggcctgccggctacgtgagcgtatcggcgatctcgaccagatcgcgtcgatcgtgctg
cacaccagccaccacacccatgtagtgatcggaacgggatccggcgatccgcagaagttc
gacccggacgcgtcacgcgaaaccctcgaccactcgctgccctacatcttcgccgtggca
ctgcaggacggctgctggcaccacgagcgctcctacgcgcccgagcgggcgcgccgttcc
gacacggtggcactgtggcacaagatttccaccgtcgaggatcccgagtggacccgccgc
tatcactgcgccgatccggccaaaaaggcgttcggggcgcgcgcggaggtgacgctgcac
agcggtgaagtgatcgtggacgaactggcggtggccgacgcccatccgctgggcacccgg
ccgttcgagcgcaagcagtacgtagagaagttcaccgagctcgccgatggtgtagtggaa
cccgttgaacagcaacggttcctggccgtagtagagagtctcgccgatctcgagagcggt
gccgtgggtgggctgaacgtgttggtcgatccgcgggtgctggacaaagcgccggtgatt
ccaccaggaatctttcgatga

DBGET integrated database retrieval system