KEGG   Mycobacterium tuberculosis H37Rv: Rv1131Help
Entry
Rv1131            CDS       T00015                                 

Gene name
prpC
Definition
(RefSeq) methylcitrate synthase PrpC
  KO
K01647  
citrate synthase [EC:2.3.3.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv1131 (prpC)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1131 (prpC)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Rv1131 (prpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1256132..1257313
Genome map
AA seq 393 aa AA seqDB search
MTGPLAAARSVAATKSMTAPTVDERPDIKKGLAGVVVDTTAISKVVPQTNSLTYRGYPVQ
DLAARCSFEQVAFLLWRGELPTDAELALFSQRERASRRVDRSMLSLLAKLPDNCHPMDVV
RTAISYLGAEDPDEDDAAANRAKAMRMMAVLPTIVAIDMRRRRGLPPIAPHSGLGYAQNF
LHMCFGEVPETAVVSAFEQSMILYAEHGFNASTFAARVVTSTQSDIYSAVTGAIGALKGR
LHGGANEAVMHDMIEIGDPANAREWLRAKLARKEKIMGFGHRVYRHGDSRVPTMKRALER
VGTVRDGQRWLDIYQVLAAEMASATGILPNLDFPTGPAYYLMGFDIASFTPIFVMSRITG
WTAHIMEQATANALIRPLSAYCGHEQRVLPGTF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggccgctcgcggcggccaggtccgtcgctgccacgaaatcgatgaccgcgccc
accgttgatgagcggcccgacatcaaaaagggcctcgccggcgtggtggtggacaccacc
gccatctccaaggtggtgccgcagaccaattcgttgacctaccggggatatccggtccag
gatctggcagcccgctgcagtttcgagcaggtcgccttcctgctgtggcgtggtgagttg
cccaccgatgccgagctggcgttgttcagccagcgcgaacgagccagccgtcgggtggac
cgctcgatgctgtcattgctggccaagctgccggacaactgccacccgatggacgtggtg
cgcaccgcgatcagctatctcggtgccgaggacccggacgaggacgacgccgcggccaac
cgggccaaggcgatgcgcatgatggcggtgttgccgacgatcgtggcgatcgacatgcgg
cgccgacgcgggttgcccccgatcgcaccgcacagcgggctcggttatgcgcagaacttc
ctgcacatgtgcttcggggaggtacccgaaaccgccgtcgtgtcggcgttcgagcagtcg
atgatcctctacgccgagcacggattcaacgcgtcgacgttcgccgcccgggtggtgacc
tcgacccaatccgacatctacagcgcggtgaccggcgcgatcggcgccctcaaggggcgg
ctacacggcggcgccaacgaagccgtcatgcacgacatgatcgagatcggcgatccggcc
aacgcgcgggagtggttgcgcgccaagctcgcccgcaaggaaaagatcatgggcttcggg
catcgggtgtaccggcacggcgactcccgggtgccgaccatgaaacgggcgctggagcgc
gtggggaccgttcgcgacggccagcgatggctggacatctaccaggtgttagcggccgag
atggcgtcggccaccgggatcttgcccaacctcgattttccgaccgggcccgcgtactac
ctgatgggattcgacatcgccagcttcaccccgatcttcgtgatgagtaggatcaccggc
tggaccgcacacatcatggaacaggccacggccaacgcgctgatccggccgctgagcgca
tattgcgggcacgagcagcgggtgttaccgggcaccttctag

DBGET integrated database retrieval system