KEGG   Mycobacterium tuberculosis H37Rv: Rv1133cHelp
Entry
Rv1133c           CDS       T00015                                 

Gene name
metE
Definition
(RefSeq) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
  KO
K00549  
5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1133c (metE)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv1133c (metE)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rv1133c (metE)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     Rv1133c (metE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(1259067..1261346)
Genome map
AA seq 759 aa AA seqDB search
MTQPVRRQPFTATITGSPRIGPRRELKRATEGYWAGRTSRSELEAVAATLRRDTWSALAA
AGLDSVPVNTFSYYDQMLDTAVLLGALPPRVSPVSDGLDRYFAAARGTDQIAPLEMTKWF
DTNYHYLVPEIGPSTTFTLHPGKVLAELKEALGQGIPARPVIIGPITFLLLSKAVDGAGA
PIERLEELVPVYSELLSLLADGGAQWVQFDEPALVTDLSPDAPALAEAVYTALCSVSNRP
AIYVATYFGDPGAALPALARTPVEAIGVDLVAGADTSVAGVPELAGKTLVAGVVDGRNVW
RTDLEAALGTLATLLGSAATVAVSTSCSTLHVPYSLEPETDLDDALRSWLAFGAEKVREV
VVLARALRDGHDAVADEIASSRAAIASRKRDPRLHNGQIRARIEAIVASGAHRGNAAQRR
ASQDARLHLPPLPTTTIGSYPQTSAIRVARAALRAGEIDEAEYVRRMRQEITEVIALQER
LGLDVLVHGEPERNDMVQYFAEQLAGFFATQNGWVQSYGSRCVRPPILYGDVSRPRAMTV
EWITYAQSLTDKPVKGMLTGPVTILAWSFVRDDQPLADTANQVALAIRDETVDLQSAGIA
VIQVDEPALRELLPLRRADQAEYLRWAVGAFRLATSGVSDATQIHTHLCYSEFGEVIGAI
ADLDADVTSIEAARSHMEVLDDLNAIGFANGVGPGVYDIHSPRVPSAEEMADSLRAALRA
VPAERLWVNPDCGLKTRNVDEVTASLHNMVAAAREVRAG
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagcctgtacgtcgtcaaccctttaccgcaaccatcaccggctccccgcgcatc
ggcccgcgccgcgaactcaagcgcgccaccgaaggctactgggccggacgtaccagccga
tccgagctggaggccgtcgccgccacgttacgccgcgacacctggtcggccctggccgcg
gccggtctggactcggtgccggtgaacaccttctcctactacgaccaaatgctcgatacc
gcggtgctgctcggcgcgctgccgccccgagtgagcccggtttccgacgggctggaccgc
tatttcgccgcggcgcggggcaccgaccagatcgcgccgctggagatgacgaagtggttc
gacaccaactaccactacctggtacccgagatcgggccgtcgaccacgttcacgctgcac
cccggcaaggtgctcgccgaactcaaagaggcgttagggcaaggcattcccgcacgtccg
gtgatcatcgggccgatcaccttcctgctgctgagcaaggccgtcgacggcgcgggggcg
ccgatcgaacgcctcgaagagttggttccggtctattcggagctgctgtcgctgcttgcc
gacggcggcgcccagtgggtgcagttcgacgagccggcgctggtgaccgacctctccccc
gacgcgcccgccctggctgaagcggtgtacaccgcgctgtgctcggtgagcaaccggcct
gcgatctatgtcgccacctacttcggggacccgggcgcggccctaccggcgctggctcgc
accccggtcgaagccatcggcgtcgacctggtggccggtgccgacacctcggtggccggg
gtacccgagctggccggcaagacgctggtggccggggtcgtcgacgggcgcaacgtctgg
cgcaccgacctggaggcggcgttgggcacgttggcgaccctgctgggttcggcggctacc
gtggccgtctcgacgtcgtgctcgacactgcacgtgccgtactcgctggaaccggaaacc
gacctggatgacgcgttgcggagctggctggcgttcggtgccgaaaaggtgcgcgaagtc
gtcgttctcgcgcgtgccctgcgcgacggacacgacgcggtcgccgacgagatcgcgtcg
tcccgcgccgccatcgcgtcccgcaagcgcgacccgcggttacacaatgggcaaatccgg
gcgcgcatcgaggcgatcgtcgcgtccggagcccaccgcggcaatgccgcccagcgccgc
gccagccaagacgcgcgactgcacctgccgccgctgccgaccacgacgatcggctcctac
ccgcagacctcggcgatccgcgttgcgcgtgcggcgctgcgggccggtgagatcgacgag
gccgagtacgtgcgccggatgcggcaagagatcaccgaggtgatcgcgctacaggagcgg
ctcgggctcgacgtgctggtgcacggcgaaccggagcgcaacgacatggtgcagtacttc
gccgagcaattggcgggtttcttcgctacccagaacggctgggtgcagtcctacggcagc
cgctgtgtgcgtccgccgatcctgtacggcgacgtgtcccggccgcgggcgatgacggtc
gagtggatcacctacgcgcagtcgctgaccgacaaaccggtgaagggcatgttgaccggg
ccggtgacgattctggcgtggtcgttcgtgcgtgacgaccagccgttggccgataccgcc
aaccaggtggcgctggcgattcgcgacgagaccgtggatttgcagtccgccggcatcgcg
gtcatccaggtcgacgagcctgcgctgcgtgaactgctgccgctgcgtcgcgccgaccag
gccgagtacttgcgttgggcggtaggggctttccggttggccacctccggcgtctcggac
gccacccagatccacacgcatctgtgctactcggagttcggcgaggtgatcggcgcgatc
gccgatctggacgcggacgtcacgtccatcgaggcggcccggtcacacatggaggtgctc
gacgacctgaacgcgatcggcttcgccaacggtgtgggcccgggcgtctatgacattcac
tcgccacgggtgccctccgctgaggagatggccgactcgttgcgggccgcgttgcgcgcg
gtgccggccgagcggctgtgggtcaaccccgactgcggactgaagacccgcaatgtcgac
gaggtgaccgcgtcgctgcacaacatggtcgccgccgcccgggaggtgcgcgcgggctag

DBGET integrated database retrieval system