KEGG   Mycobacterium tuberculosis H37Rv: Rv1144Help
Entry
Rv1144            CDS       T00015                                 

Definition
(RefSeq) oxidoreductase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1271156..1271908
Genome map
AA seq 250 aa AA seqDB search
MKTKDAVAVVTGGASGLGLATTKRLLDAGAQVVVVDLRGDDVVGGLGDRARFAQADVTDE
AAVSNALELADSLGPVRVVVNCAGTGNAIRVLSRDGVFPLAAFRKIVDINLVGTFNVLRL
GAERIAKTEPIGEERGVIINTASVAAFDGQIGQAAYSASKGGVVGMTLPIARDLASKLIR
VVTIAPGLFDTPLLASLPAEAKASLGQQVPHPSRLGNPDEYGALVLHIIENPMLNGEVIR
LDGAIRMAPR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaaagacgccgtagccgttgtcaccggtggcgcctcaggcctgggtctggcc
accaccaagcggctattggacgctggggcacaggtggtcgtcgtggacctccgcggcgac
gacgtggttggcgggctcggcgatcgcgcgcgttttgcgcaagccgacgtcaccgacgaa
gccgccgtcagcaacgcgctagagctggcggattcgctcggcccggtgcgggtcgtcgtc
aactgcgccggcaccggcaacgcgattcgcgtactgagtcgcgacggcgtgttcccgctg
gccgcgttccgcaagatcgtggacatcaacctagtcggcaccttcaacgtgctgcgactg
ggcgccgagcggatcgccaagaccgaaccgattggggaagagcgcggcgtcatcattaac
accgcctcggtggcggcattcgacggtcagatcggccaggccgcctactcggcgtccaag
ggcggcgtagttggcatgaccctgccgatcgcccgcgatctggccagcaagctgatccgg
gtggtcaccattgcgccgggtctgttcgacaccccgctgctggcttcattgccggcggag
gccaaggcctcactgggccaacaggtgccgcatccctcgcggctgggcaaccccgacgag
tacggggcgctagttctgcacatcatcgaaaacccgatgcttaacggcgaggtcatccgt
ctggacggcgccatccgcatggcgccgcgctaa

DBGET integrated database retrieval system