KEGG   Mycobacterium tuberculosis H37Rv: Rv1161Help
Entry
Rv1161            CDS       T00015                                 

Gene name
narG
Definition
(RefSeq) nitrate reductase subunit alpha
  KO
K00370  
nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Rv1161 (narG)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rv1161 (narG)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     Rv1161 (narG)
   1.7.99  With unknown physiological acceptors
    1.7.99.4  nitrate reductase
     Rv1161 (narG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1287328..1291026
Genome map
AA seq 1232 aa AA seqDB search
MTVTPHVGGPLEELLERSGRFFTPGEFSADLRTVTRRGGREGDVFYRDRWSHDKVVRSTH
GVNCTGSCSWKIYVKDGIITWETQQTDYPSVGPDRPEYEPRGCPRGASFSWYSYSPTRVR
YPYARGVLVEMYREAKTRLGDPVLAWADIQADPERRRRYQQARGKGGLVRVSWAEASEMV
AAAHVHTIKTYGPDRVAGFSPIPAMSMVSHAAGSRFVELIGGVMTSFYDWYADLPVASPQ
VFGDQTDVPESGDWWDASYLVMWGSNVPITRTPDAHWMAEARYRGAKVVVVSPDYADNTK
FADEWVRCAAGTDTALAMAMGHVILSECYVRNQVPFFVDYVRRYTDLPFLIKLEKRGDLL
VPGKFLTAADIGEESENAAFKPALLDELTNTVVVPQGSLGFRFGEDGVGKWNLDLGSVVP
ALSVEMDKAVNGDRSAELVTLPSFDTIDGHGETVSRGVPVRRAGKHLVCTVFDLMLAHYG
VARAGLPGEWPTGYHDRTQQNTPAWQESITGVPAAQAIRFAKEFARNATESGGRSMIIMG
GGICHWFHSDVMYRSVLALLMLTGSMGRNGGGWAHYVGQEKVRPLTGWQTMAMATDWSRP
PRQVPGASYWYAHTDQWRYDGYGADKLASPVGRGRFAGKHTMDLLTSATAMGWSPFYPQF
DRSSLDVADEARAAGRDVGDYVAEQLAQHKLKLSITDPDNPVNWPRVLTVWRANLIGSSG
KGGEYFLRHLLGTDSNVQSDPPTDGVHPRDVVWDSDIPEGKLDLIMSIDFRMTSTTLVSD
VVLPAATWYEKSDLSSTDMHPYVHSFSPAIDPPWETRSDFDAFAAIARAFSALAKRHLGT
RTDVVLTALQHDTPDEMAYPDGTERDWLATGEVPVPGRTMSKLTVVERDYTAIYDKWLTL
GPLIDQFGMTTKGYTVHPFREVSELAANFGVMNSGVAVGRPAITTAKRMADVILALSGTC
NGRLAVEGFLELEKRTGQRLAHLAEGSEERRITYADTQARPVPVITSPEWSGSESGGRRY
APFTINIEHLKPFHTLTGRMHFYLAHDWVEELGEQLPVYRPPLDMARLFNQPELGPTDDG
LGLTVRYLTPHSKWSFHSTYQDNLYMLSLSRGGPTMWMSPGDAAKINVRDNDWVEAVNAN
GIYVCRAIVSHRMPEGVVFVYHVQERTVDTPRTETNGKRGGNHNALTRVRIKPSHLAGGY
GQHAFAFNYLGPTGNQRDEVTVVRRRSQEVRY
NT seq 3699 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgttacacctcacgtcggtggaccgctcgaagagctgctggagcgcagcgggcgc
ttcttcaccccaggtgagttctcggccgacctgcgcaccgtaacccggcgcggcggccgc
gaaggtgacgtgttctaccgcgatcggtggagtcacgacaaagtggtccgatccacgcac
ggagtcaactgcaccggatcctgctcatggaagatctacgtcaaagacgggatcatcacc
tgggaaacccagcagaccgactacccgtcggtgggcccggaccggcccgaatacgagcca
cgaggttgtccccgtggcgcgtcgttctcctggtacagctattcgccgacgcgggtgcgc
tatccgtatgcccggggcgtgctggttgagatgtaccgggaagccaagacccgcctgggc
gacccggtgctggcgtgggccgacattcaggcggatcccgagcgcagacgccgctatcaa
caggcccgcggcaagggtgggctggtccgggtgagctgggccgaggccagcgagatggtg
gccgccgcccacgtgcacaccatcaagacatacggcccggaccgggtcgccggcttctcg
ccgattccggcgatgtcaatggtcagccatgccgcggggtcccggttcgtggagctgatc
ggcggcgtgatgacgtcgttctacgactggtacgccgacttgccggtggcctcgccgcag
gtgttcggcgaccagaccgacgtgcccgaatccggcgactggtgggatgcgtcgtatttg
gtcatgtggggctccaacgtcccgatcacccggacgcccgacgcacattggatggcggag
gcccgttaccgcggcgctaaagtcgttgtcgtcagcccggactacgccgacaacaccaag
ttcgccgacgagtgggtgcggtgcgccgccggtaccgataccgcgctggcgatggcgatg
ggccacgtgatcctgtcggaatgttacgtccgtaaccaggttccgttctttgtcgactat
gtgcgccgctacaccgacctgccgtttttgatcaagttggaaaagcggggcgacctgctg
gttcccggaaagttcttgaccgcggccgacattggtgaagaaagtgagaacgcggcgttc
aaacccgccctgctggatgagcttacgaataccgttgtcgtgccgcagggctcactggga
ttccgtttcggtgaggacggtgttgggaagtggaacctggacctgggttcggtggtgccg
gcgctaagtgtggagatggacaaggctgtcaacggcgatcgcagtgctgaactggttacg
ctgcccagctttgacaccatcgacgggcacggtgagacggtgtcgcgtggggtgccggtg
cgccgggcgggcaagcatctggtgtgcacggtgttcgatctgatgttggcccactacggg
gtggcgcgtgcggggctgcccggcgaatggccgaccggctaccacgaccgaacccagcag
aacaccccggcctggcaggagtcgatcaccggtgtgccggccgcgcaggcaatccggttt
gccaaggaattcgcccgcaacgcgaccgaatccggaggacggtcgatgatcatcatgggc
ggcggaatctgtcactggttccacagcgatgtcatgtaccgctcggtgttggcgctgctc
atgttgaccggatcgatgggacgcaacggcggcgggtgggcgcactacgtcggccaggag
aaggtgcgtccgttgaccgggtggcagacgatggcgatggccaccgactggtcgcggccg
ccgcgtcaggtgcccggcgcgtcgtactggtatgcgcacaccgaccaatggcgctacgac
ggctacggcgcggacaagcttgccagcccggtgggtcgcggcaggttcgccggcaagcac
accatggacctgctgacctcggccacggcgatgggctggagcccgttctatccacaattc
gatcggtccagtctcgatgtcgccgacgaggcccgcgccgcgggccgcgacgtgggtgat
tacgtcgccgaacaacttgcccagcacaagctgaagctctcgattaccgatccggataac
ccggtcaactggccgcgggtgctcaccgtctggcgggcgaacctgatcggctcgtcgggc
aagggcggcgagtatttcttgcggcatctgctgggcaccgactccaacgtacagtccgac
cctcccaccgacggtgtgcatccccgggatgtggtgtgggacagcgacattccagagggc
aagctcgacctgataatgtcgatcgacttccggatgacgtcgacgacgctggtgtcggat
gtcgtgttgcccgccgcgacctggtacgagaaatccgacctgtccagtaccgatatgcac
ccgtacgtgcactcgttcagtccggcgatcgatccgccgtgggaaacccgttcggacttt
gacgcattcgccgccatcgcgcgtgctttcagtgcgctggcgaaacgtcatctgggcact
cgcaccgatgtggtgctgaccgcgctgcagcacgacaccccggatgagatggcatatccc
gatggcaccgaacgtgattggctggcgaccggagaagtcccggtgccaggcaggacgatg
agcaagctcactgtggtggagcgggactacaccgcgatctacgacaagtggctgaccctg
ggaccgctcatcgaccagttcgggatgaccaccaagggatataccgtccatcccttccgg
gaggtcagcgagctggcagccaacttcggggtgatgaattccggtgtggcggtgggtcgt
ccggcgatcaccacggctaagcggatggctgacgtgatcctggcgctgtccggcacatgc
aacgggcgactcgcggtcgagggattcctcgagctggagaagcgtaccgggcagcggctg
gctcatctggccgagggcagcgaggaacgccgcatcacctacgccgatacccaggcgcgt
cccgtgccggtgatcaccagcccggaatggtcgggcagcgagagcggtggccgccgctac
gcgccgttcacgatcaacatcgagcatcttaagccgtttcacacgctcaccgggcgtatg
cacttctacctggcgcatgactgggtcgaagaactcggcgagcagttgcccgtctatcgg
ccgccgctggacatggcgcggctgttcaaccagcccgagctcggaccgaccgacgatgga
ctcgggctcaccgtgcgctatctgacgccgcactccaagtggtcgtttcactcgacctac
caggacaacctatacatgttgtcgttgtcccgtggcggtccgacgatgtggatgagcccg
ggtgacgcggcgaaaatcaatgtgcgcgacaatgattgggtagaggcggtcaatgccaac
ggcatctacgtgtgccgggcaatcgtcagccaccggatgcccgagggtgtggtgttcgtc
taccacgtgcaggagcgcaccgtggacacgccgcgcaccgagaccaacggcaaacgcggc
ggcaaccataacgcgctgacccgcgtacgaatcaaacccagccacctggccggtggctac
ggccagcacgcgttcgcgttcaactacctgggtccgaccggtaaccagcgtgacgaggtg
accgtggtgcgccgccgcagccaggaagtgcggtactga

DBGET integrated database retrieval system