KEGG   Mycobacterium tuberculosis H37Rv: Rv1170Help
Entry
Rv1170            CDS       T00015                                 

Gene name
mshB
Definition
(RefSeq) 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase
  KO
K15525  
N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase [EC:3.5.1.103]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.103  N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase
     Rv1170 (mshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1300304..1301215
Genome map
AA seq 303 aa AA seqDB search
MSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADH
ADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGA
LVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKF
YWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAA
LAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTA
SGT
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagacgccgcggctgctgtttgttcatgcacaccccgacgatgagagcctgagc
aacggcgcaaccatcgcgcactacacctcccgtggcgcacaggtccatgtcgtcacgtgc
accctgggtgaggagggcgaggtcattggcgatcgctgggctcaactcaccgccgatcat
gcggaccaactcggtggctaccgcatcggcgagctcaccgcggcgttgcgagcgctcggg
gtcagcgcaccgatctaccttggcggcgcgggtcgctggcgcgactccggcatggccggc
acagaccagcggagtcagcggagattcgtcgatgctgacccccggcagaccgtcggggca
ttggtcgcgatcattcgcgagctgcggccgcatgtcgtggtgacctatgaccccaatggc
ggttacggtcatcctgaccacgtgcacacccacaccgtcactaccgccgcggtggccgca
gcgggtgttgggtccggtaccgcagatcaccccggcgacccgtggacggtgccgaagttc
tactggacggtcttgggtctgagcgcgctcatttcgggcgcgcgagccctggtccccgac
gatctgcgacccgaatgggtgttgccgcgggccgacgagattgcattcgggtactccgac
gacggtatcgacgccgtcgtcgaggccgatgagcaggcgcgagccgccaaggttgcggca
ctggctgcccatgccacccaagttgtcgtcggcccgaccggccgggccgccgccttgtcg
aacaacctggcactgcccatcctggccgatgagcattacgtgctcgccggcggctccgcg
ggcgcccgcgatgaacgtggctgggaaactgatctgctcgccggtctgggcttcaccgcg
tccggcacgtag

DBGET integrated database retrieval system